HUBUNGAN MOTIVASI BELAJAR SISWA DENGAN AKTIVITAS BELAJAR SISWA PADA MATA PELAJARAN EKONOMI.

Save this PDF as:
 WORD  PNG  TXT  JPG

Ukuran: px
Mulai penontonan dengan halaman:

Download "HUBUNGAN MOTIVASI BELAJAR SISWA DENGAN AKTIVITAS BELAJAR SISWA PADA MATA PELAJARAN EKONOMI."

Transkripsi

1 HUBUNGAN MOTIVASI BELAJAR SISWA DENGAN AKTIVITAS BELAJAR SISWA PADA MATA PELAJARAN EKONOMI. SitiHardiyanti, HamzahYunus *, MeykoPanigoro ** JurusanPendidikanEkonomi, Program Studi S1. Pend. Ekonomi FEBUniversitas Negeri Gorontalo ABSTRAK Penelitian ini dilaksanakan berdasarkan rumusan masalah: Apakah terdapat hubungan motivasi dengan aktivitas belajar siswa pada mata pelajaran ekonomi di kelas XI SMA Negeri 1 Gorontalo Metode Penelitian yang digunakan adalah Kuantitatif, sampel penelitian berjumlah 56 orang siswa dikelas pada mata pelajaran ekonomi di kelas XI SMA Negeri 1 Gorontalo.Berdasarkan hasil penelitian, diperoleh bahwa Dari hasil perhitungan statistik, koefisien determinasi koefisienkorelasi (r) = 0,68 dan Koefisien Determinasi = 46,24%. Hal ini menunjukkan bahwa aktivitas belajar siswa sebesar 46,24% di tentukan oleh motivas ibelajar siswa sedangkan sisanya 53,76% di dipengaruhi oleh variabel lain, sedangkan daftar distribusi t pada taraf nyata 5% (α = 0,05) di peroleh = 2,01, dari hasil tersebut di peroleh lebih besar dari pada (6,84 2,01) atau harga telah berada di luar penerimaan, sehingga korelasi di atas benar-benar signifikan.dengan demikian hipotesis tindakan yang berbunyi Terdapat hubungan antara motivasi dengan aktivitas belajar siswa pada mata pelajaran ekonomi di Kelas XI SMA Negeri 1 Gorontalo dinyatakan signifikan dan dapat diterima. Kata Kunci : Motivasi, Aktivitas Belajar Siswa PENDAHULUAN Pendidikan merupakan usaha sadar untuk menumbuhkembangkan potensi sumber daya manusia melalui kegiatan pengajaran. UU sistem pendidikan manusia No.20 tahun 2003, menyatakan bahwa tujuan pendidikan nasional adalah mencerdasarkan kehidupan bangsa dan mengembangkan manusia Indonesia seutuhnya yaitu manusia yang bertaqwa terhadap Tuhan Yang Maha Esa dan berbudi pekerti luhur, memiliki pengetahuan dan keterampilan, kesehatan jasmani dan rohani, kepribadian yang mantap dan mandiri serta bertanggung jawab kemasyarakatan dan 1

2 kebangsaan (UU Sisdiknas : 2003). Salah satu masalah yang dihadapi dunia pendidikan kita adalah masih lemahnya proses pembelajaran. Dalam proses pembelajaran, anak didik kurang didorong untuk mengembangkan kemampuan berpikir. Proses pembelajaran di dalam kelas diarahkan kepada kemampuan anak untuk menghafal informasi, tanpa dituntut untuk memahami informasi yang diingatnya itu untuk menghubungkannya dengan kehidupan sehari-hari. Tujuan proses belajar mengajar secara ideal adalah agar bahan yang dipelajari dikuasai sepenuhnya oleh peserta didik. Pengajar mengemban tugas utamanya adalah mendidik dan membimbing peserta didik untuk belajar serta mengembangkan dirinya.di dalam tugasnya seorang guru diharapkan dapat membantu siswa dalam memberi pengalaman-pengalaman lain untuk membentuk kehidupan sebagai individu yang dapat hidup mandiri ditengah-tengah masyarakat modern.jadi, masalah yang sangat penting yang kita hadapi ialah bagaimana usaha agar sebagian besar dari peserta didik dapat belajar dengan efektif dan menguasai bahan pelajaran dan keterampilan-keterampilan yang diangap esensial bagi perkembangannya selanjutnya dalam masyarakat yang kian hari semakin kompleks. Pembelajaran yang diikuti oleh peserta didik yang termotivasi akan benarbenar menyenangkan apabila pendidik dapat mengetahui waktu/keadaan kapan peserta didik perlu dimotivasi selama proses belajar. Peserta didik yang menyelesaikan pengalaman belajar dan menyelesaikan tugas belajar dengan perasaan termotivasi terhadap materi yang telah dipelajari peserta didik akan lebih mungkin menggunakan materi yang telah dipelajari. Hal yang perlu dipertimbangkan dalam memotivasi peserta didik adalah kemampuan anak di dalam melakukan aktivitas belajar dan kegiatan pembelajaran yang menarik. Siswa yang bermotivasi tinggi dalam belajar memungkinkan akan memperoleh hasil belajar yang tinggi pula, artinya semakin tinggi motivasinya semakin intensitas usaha dan upaya yang dilakukan, maka semakin tinggi hasil belajar yang diperolehnya. Siswa melakukan berbagai upaya atau usaha untuk meningkatkan motivasi dalam belajar sehingga mencapai keberhasilan yang memuaskan sebagaimana yang diharapkan. Dalam proses belajar mengajar, faktor aktivitas adalah hal yang tidak bisa diabaikan. Dengan kata lain, bahwa dalam belajar diperlukan adanya aktivitas. Tanpa adanya aktivitas belajar siswa, tidak mungkin kegiatan pembelajaran berlangsung dengan baik. Dengan adanya aktivitas belajar yang dimiliki siswa,diharapkan hasil 2

3 belajar siswa akan meningkat. Berdasarkan hasil observasi yang dilakukan peneliti di SMA Negeri 1 Gorontalo guru sudah berusaha dengan semaksimal mungkin untuk menumbuhkan motivasi dan aktivitas belajar siswa sehingga diharapkan aktivitas belajarnya juga akan meningkat. Namun kenyataannya peneliti melihat dalam proses belajar mengajar masih banyak siswa yang mengalami kesulitan belajarnya, terlihat dari masih banyaknya siswa yang tidak memperhatikan dengan baik materi pelajaran, hal ini disebabkan karena adanya unsur-unsur dinamis siswa dalam belajar yang turut memberikan pengaruh, misalnya keadaaan emosional siswa, gairah belajar dan situasi dalam keluarga. Masih terdapat siswa yang belum aktif dalam mengerjakan soal latihan yang diberikan, sehingga hasil belajarnya pun menjadi kurang memuaskan, dan masih kurangnya kemampuan siswa dalam menyampaikan pendapat atau melakukan tanya jawab dalam kelas.selain itu, masih kurangnya peran guru dalam menumbuhkan motivasi belajar siswa dalam memberikan penguatan-penguatan, seringkali guru dalam menjelaskan materi kurang memperdulikan apakah materi yang disampaikan dapat dimengerti oleh siswa atau tidak karena pendekatan pembelajaran yang dilaksanakan monoton konvensional dan pada gilirannya siswa hanya menyimak guru mengajar tanpa adanya aktivitas pembelajaran yang menarik bagi siswa. Berdasarkan masalah yang dipaparkan di atas, maka peneliti sangat tertarik untuk mengadakan penelitian ilmiah dengan formulasi judul Hubungan Motivasi Belajar Siswa Dengan Aktivitas Belajar Siswa Pada Mata Pelajaran Ekonomi di Kelas XISMA Negeri 1 Gorontalo Secara etimologis aktivitas berasal dari kata aktif yang berarti giat rajin.dalam aktivitas dapat diartikan sebagai suatu kegiatan atau keberhasilan seseorang dalam mengerjakan suatu pekerjaan yang melibatkan fisik dan mental seseorang.sedangkan belajar pada prinsipnya adalah berbuat untuk mengubah tingkah laku menjadi kegiatan.tidak ada belajar jika tidak ada aktivitas.itulah sebabnya aktivitas merupakan prinsip atau azas yang sangat penting di dalam interaksi belajar mengajar.sebagai rasionalitasnya hal ini juga mendapatkan pengakuan dari berbagai ahli pendidikan.frobel (dalam Sadirman 2004:96) mengatakan bahwa Manusia sebagai pencipta.dalam ajaran agama pun diakui bahwa manusia adalah sebagai pencipta kedua (setelah Tuhan).Secara alami anak didik memang berhak untuk mencipta.anak adalah suatu organisme yang berkembang dari dalam.prinsip utama 3

4 yang dikemukakan oleh Frobel bahwa anak itu harus bekerja sendiri.untuk memberikan motivasi maka dipopulerkan suatu semboyan berpikir dan berbuat.dalam dinamika kehidupan manusia, berpikir dan berbuat adalah suatu rangkaian yang tidak dapat dipisahkan, begitu juga dalam belajar sudah barang tentu tidak mungkin meninggalkan kedua kegiatan itu yaitu berpikir dan berbuat. Sehingga bila dihubungkan dengan kedua pengertian di atas, aktivitas yang dimaksud adalah aktivitas yang bersifat mental.dalam kaitannya di pembelajaran ekonomi, aktivitas belajar siswa adalah suatu kegiatan yang dilakukan oleh seseorang untuk mencari keahlian atau kepandaian dalam pembelajaran ekonomi. Antara aktivitas dan proses belajar merupakan dua proses tingkah laku yang melibatkan siswa pada suatu kesibukan, sebab pada hakikatnya belajar merupakan suatu aktivitas. Montessori (dalam Sadirman, 2004:96) juga menegaskan bahwa anak-anak memiliki tenaga untuk berkembang sendiri dan membentuk sendiri. Pendidik akan berperan sebagai pembimbing dan mengamati bagaimana perkembangan anak-anak didiknya. Pernyataan Montessori ini memberikan petunjuk bahwa yang lebih banyak melakukan aktivitas di dalam pembentukan diri adalah anak itu sendiri, sedangkan pendidik memberikan bimbingan dan merencanakan segala kegiatan yang akan diperbuat oleh anak didik. Dalam hal kegiatan belajar mengajar ini, Rousseau (dalam Sadirman 2004:96) memberikan penjelasan bahwa segala pengetahuan itu harus diperoleh dengan pengamatan sendiri, pengalaman sendiri, dengan fasilitas yang diciptakan sendiri baik secara rohani maupun teknis. Ilustrasi ini diambil dari pelajaran ilmu bumi, ini menunjukan setiap orang yang belajar harus aktif sendiri. Tanpa ada aktivitas, proses belajar tidak akan terjadi. Oleh sebab itu, Helen Parkhust (dalam Sadirman, 2006: 97) menegaskan bahwa ruang kelas harus diubah/diatur sedemikian rupa menjadi laboratorium pendidikan yang mendorong anak didik bekerja sendiri. Menurut Sardirman (2006:73) bahwa Motivasi berpangkal dari kata motif yang dapat diartikan sebagai daya penggerak yang ada di dalam diri seseorang untuk melakukan aktivitas-aktivitas tertentu demi tercapainya suatu tujuan. Bahkan motif dapat diartikan sebagai suatu kondisi intern (kesiapsiagaan). Berawal dari kata motif maka motivasi dapat diartikan sebagai daya penggerak yang telah menjadi aktif. Motif menjadi aktif pada saat-saat tertentu, terutama bila kebutuhan untuk mencapai tujuan sangat dirasakan/mendesak. 4

5 Selanjutnya menurut Koeswara dkk (dalam Mudjiono dan Dimyanti, 2009:80) bahwa Motivasi dipandang sebagai dorongan mental yang menggerakan, menyalurkan, dan mengarahkan sikap dan perilaku individu belajar. Dalam motivasi terkandung adanya keinginan yang mengaktifkan, menggerakan, menyalurkan dan mengarahkan sikap dan prilaku individu belajar. Sedangkan Eysenck (dalam Slameto,2003:170) merumuskan Motivasi sebagai suatu proses yang menentukan tindakan kegiatan, interaksi, konsistensi, serta arah umum dari tingkah laku manusia, merupakan konsep yang rumitdan berkaitan dengan konsep-konsep lain seperti minat, konsep diri, sikap dan sebagainya. Siswa yang tampaknya tidak bermotivasi, tetapi tidak dalam hal-hal yang diharapkan oleh para pengajar. Mungkin siswa cukup termotivasi untuk berprestasi di sekolah oleh para pengajar. Mungkin ada kekuatan-kekuatan lain, seperti misalnya teman-teman yang mendorong untuk tidak berprestasi di sekolah. Namun pada intinya bahwa motivasi merupakan kondisi psikologis yang mendorong seseorang untuk melakukan sesuatu. Dalam kegiatan belajar, motivasi dapat dikatakan sebagai keseluruhan daya penggerak di dalam diri siswa yang menimbulkan, menjamin kelangsungan dan memberikan arah kegiatan belajar, sehingga diharapkan tujuan dapat tercapai. Dalam kegiatan belajar, motivasi sangat diperlukan, sebab seseorang yang tidak mempunyai motivasi dalam belajar, tidak akan mungkin melakukan aktivitas belajar. Tujuan pelaksanaan penelitian ini adalah untuk mengetahui hubungan motivasi dengan aktivitas belajar siswa pada mata pelajaran ekonomi di kelas XI SMA Negeri 1 Gorontalo.. METODE PENULISAN Peneliti menetapkan objek penelitian pada siswa SMA Negeri 1 Gorontalo di kelas XI. Penetapan lokasi tersebut berdasarkan pada beberapa alasan bahwa objek tersebut sesuai dengan tujuan penelitian, selain itu data yang akan digunakan sebagai bahan penelitian cukup memadai dan mudah untuk memperolehnya, baik dilihat dari segi waktu, biaya dan tenaga yang diperlukan. Penelitian ini dilaksanakan SMA Negeri 1 Gorontalo di kelas XI. Penelitian ini dilaksanakan selama kurang lebih 6 bulan dari bulan Januari sampai bulan Juli Metode yang dipergunakan dalam penelitian ini kuantitatif. Melalui metode ini, dapat dilihat masalah yang akan diteliti pada masing-masing variabel, baik variabel X 5

6 (independent variable) maupun variabel Y (dependent variable). Dalam kaitan ini, Arikunto (2002:97), mengemukakan bahwa variabel yang mempengaruhi disebut variabel penyebab, variabel bebas atau independent variabel (X), sedangkan variabel terikat disebut variabel tidak bebas, variabel tergantung atau dependent variabel (Y). Untuk mendukung penelitian ini, digunakan teknik pengumpulan data yang terdiri dari observasi, angket dan dokumentasi. Metode yang dipergunakan dalam penelitian ini kuantitatif. Melalui metode ini, dapat dilihat masalah yang akan diteliti pada masing-masing variabel, baik variabel X (independent variable) maupun variabel Y (dependent variable). Dalam kaitan ini, Arikunto (2002:97), mengemukakan bahwa variabel yang mempengaruhi disebut variabel penyebab, variabel bebas atau independent variabel (X), sedangkan variabel terikat disebut variabel tidak bebas, variabel tergantung atau dependent variabel (Y). Berdasarkan hal ini, dapat dikemukakan bahwa motivasi belajar siswa (sebagai variabel X) berhubungan positif dengan aktivitas belajar siswa sebagai variabel Y (sesuai hipotesis penelitian), sehingga dapat dirumuskan desain penelitian sebagai berikut : Variabel Variabel X Y Gambar 2. Desain Penelitian Keterangan : X = Motivasi Belajar Siswa Y = Aktivitas Belajar Siswa HASIL DAN PEMBAHASAN Uji analisis ini dimaksudkan untuk mengukur validitas setiap item soal, maka terlebih dahulu diuji kesejajaran anggota skor item dan skor total apabila terdapat kesejajaran berarti semua item soal mempunyai tingkat validitas yang baik. Menurut Suyuti (2010), nilai validitas berada pada angka 0,30 atau 0,30. 6

7 Kesejajaran dapat dihitung dengan menggunakan korelasi product moment, yakni dengan memasukkan harga-harga ΣX, ΣY, ΣX², ΣY², Σ(XY)², dan ΣX.Y ke dalam rumus. Kemudian nilai r untuk setiap item, harga r tersebut dapat dilihat pada lampiran 5 dan lampiran 6 maka dapat di interprestasikan bahwa skor masingmasing item dari variabel X dan Y mempunyai korelasi yang signifikan dengan kata lain bahwa semua item adalah valid. Pada penggunaan instrument penelitian digunakan rumus korelasi Product Moment sebagaimana terlampir, diperoleh hasil validitas seperti yang tertera pada tabel berikut : Tabel 6. Koefisien Validasi dan Status Validitas Variabel X Butir Nilai Butir Keterangan Soal r Soal Nilai r Keterangan 1 0,41 Valid 9 0,36 Valid 2 0,31 Valid 10 0,8 Valid 3 0,3 Valid 11 0,69 Valid 4 0,65 Valid 12 0,89 Valid 5 0,56 Valid 13 0,72 Valid 6 0,5 Valid 14 0,53 Valid 7 0,41 Valid 15 0,42 Valid 8 0,4 Valid Data Hasil Olahan, Mei 2013 Tabel 7. KoefisienValiditas dan StatusValiditasVariabel Y Butir Soal Nilai r Keterangan Butir Soal Nilai r Keterangan 1 0,35 Valid 9 0,85 Valid 2 0,33 Valid 10 0,35 Valid 3 0,54 Valid 11 0,38 Valid 4 0,44 Valid 12 0,41 Valid 5 0,64 Valid 13 0,6 Valid 6 0,3 Valid 14 0,33 Valid 7 0,35 Valid 15 0,55 Valid 8 0,5 Valid Data Hasil Olahan, Mei

8 Berdasarkan nilai-nilai pada tabel 1 dan 2 tersebut, dari 30 butir item yang terdiri dari 15 butir angket oleh variabel X dan 15 butir angket untuk variabel Y, memiliki korelasi yang signifikan dengan skor total atau valid dan cukup baik sebagai alat pengumpul data dimana nilainya di atas dari 0,30. Dengan demikian, maka angket yang digunakan dalam penelitian ini telah memenuhi persyaratan untuk menguji Hubungan Motivasi Belajar Siswa Dengan Aktivitas Belajar Siswa Pada Mata Pelajaran Ekonomi di Kelas XI SMA Negeri 1 Gorontalo. Berdasarkan data hasil yang diperoleh melalui penyebaran angket, dapat di ketahui bahwa motivasibelajarsiswadenganaktivitasbelajarsiswamemilikimotivasiyang cukupsignifikan, hal ini diperoleh dari hasil jawaban dari setiap siswasebagai sampel penelitian. Dari hasil penyebaran angket pada responden disma Negeri 1 Gorontaloyang berjumlah 56 orang, bahwa Pemberian skor dan penilaian data penelitian di peroleh data terbesar 65, data terkecil 34, sehingga rentang data (r) 31, Banyaknya kelas (K) 7, dan panjang kelas (P) 5 (perhitungan terlampir), sehingga distribusi frekuensi pengamatan variabel X adalah sebagai berikut: Tabel 8. Daftar Distribusi Frekuensi Pengamatan Variabel X No Kelas Interval Frekuensi Jumlah 56 Dengan adanya grafik di atas, menunjukkan bahwa lebih banyak responden yang menjawab item pertanyaan anrara yaitu dengan frekuensi 17. Dari hasil pengamatan data penelitian menunjukkan bahwa nilai rata-rata ( ) 47,43dan simpangan baku (S) 5,98, selanjutnya median atau nilai tengah atau perbatasan dari suatu distribusi frekuensi dengan kata lain nilai median membatasi 8

9 50% distribusi sebelah atas dan sebelah bawah dengan harga median 47,88 sedangkan untuk nilai modus 49,41. Aktivitas belajar siswa sebagai variabel Y mempunyai skor yang sesuai dengan data yang dikumpulkan dari hasil penyebaran angket kepada responden yang ada di SMA Negeri 1 Gorontalo, menunjukkan bahwa pada pembagian skor serta penilaian data, di peroleh data terbesar 68 dan data terkecil 35, sehingga rentang datanya (r) 33, sedangkan banyaknya kelas (K) 7 dan panjang kelas (P) 5, sehingga distribusi pengamatan variabel Y adalah sebagai berikut: Tabel 9. Daftar Distribusi Frekuensi Pengamatan Variabel Y No Kelas Interval Frekuensi Di lihat dari tabel di atas, menunjukkan bahwa variabel Y dalam hal ini aktivitasbelajarsiswa adalah tidak merata. Data membuktikan untuk skor lebih banyak frekuensinya dibandingkan dengan data lainnya. Untuk kejelasan mengenai distribusi frekuensi variabel Y, Pada pengolahan data hasil penelitian aktivitas belajar siswa menunjukkan nilai rata-rata 48,96 dan simpangan baku (S) 7,1 (perhitungan terlampir) selanjutnya median atau nilai tengah atau perbatasan dari suatu distribusi frekuensi dengan kata lain nilai median membatasi 50% distribusi sebelah atas dan sebelah bawah menunjukkan harga median 48, sedangkan modus 47,08. Dengan demikian hipotesis pada penelitian ini hasilnya menunjukkan bahwa Hipotesis yang di uji di tolak, dan sebaliknya hipotesis penelitian yang di ajukan di terima. Hal ini terlihat dari semua harga lebih besar dari baik pada taraf signifikan (α) = 0,05. Adapun hipotesis yang di ajukan adalah Terdapat hubungan antara motivasi dengan aktivitas belajar siswa pada mata pelajaran ekonomi di Kelas XI SMA Negeri 1 Gorontalo, Diterima. 9

10 Berdasarkan permasalah yang telah di temukan sebelumnya, serta rumusan hipotesis yang berbunyi Terdapat hubungan antara motivasi dengan aktivitas belajar siswa pada mata pelajaran ekonomi di Kelas XI SMA Negeri 1 Gorontalo. perlu di tentukan statistika uji yang di gunakan sehubungan dengan masalah yang di teliti. KESIMPULAN DAN SARAN Berdasarkan hasil penelitian yang dilakukan untuk menganalisis hubungan motivasibelajarsiswa dengan aktivitasbelajarsiswa yang telah diuraikan sebelumnya, maka dapat diambil kesimpulan sebagai berikut: Hipotesis yang berbunyi Terdapat hubungan antara motivasi belajardengan aktivitas belajar siswa pada mata pelajaran ekonomi di Kelas XI SMA Negeri 1 Gorontalo dinyatakansignifikandandapatditerima. Dari hasil perhitungan statistik, koefisien determinasi koefisienkorelasi (r) = 0,68 dankoefisiendeterminasi = 46,24%. Hal ini menunjukkan bahwa aktivitas belajar siswasebesar 46,24% di tentukan oleh motivasibelajarsiswa sedangkan sisanya 53,76% di dipengaruhi oleh variabel lain, sedangkan daftar distribusi t pada taraf nyata 5% (α = 0,05) di peroleh = 2,01, dari hasil tersebut di peroleh lebih besar dari pada (6,84 2,01) atau harga telah berada di luar penerimaan, sehingga korelasi di atas benar-benar mengetahu hubungan motivasi dengan aktivitas belajar siswa pada mata pelajaran ekonomi di kelas XI SMA Negeri 1 Gorontalo. Sampel dalam penelitian ini berjumlah 56 orang siswa, Peneliti menggunakan metode kuantitatif. Penelitian ini menggunakan uji validitas dan reliabilitas dengan teknik analisa data menggunakan analisis regresi dan korelasi. Hasil penelitian menunjukkan bahwa hubungan yang positif antara variabel X (motivasi belajar siswa) dengan variabel Y (Aktivitas belajar siswa) pada mata pelajaran Ekonomi di SMA Negeri 1 Gorontalo. Berdasarkan pada pembahasan dan simpulan yang telah dikemukakan diatas, maka peneliti mengemukakan beberapa saran sebagai berikut : Kepada Kepala SekolahSMA Negeri 1 Gorontalo sebagai pengambil kebijakan dan khususnya para guru dalam memberikan stimulus dalam upaya meningkatkan aktivitas belajar siswa agar kiranya pemberian penghargaan kepada siswa dalam proses pembelajaran dapat lebih inovatif, karena dengan pemberian motivasi yang baik dan tepat, akan dapat meningkatkan aktivitas belajar siswa yang\ 10

11 kemudian akan berorientasi pada prestasi belajar siswa.kepada para peneliti selanjutnya agar bias menambah variable yang berhubungan dengan judul skripsi ini. DAFTAR RUJUKAN Fathurrohman dan Sutikno. (2009). Strategi Belajar Mengajar. Bandung: PT. Refika Aditama. Imron, Ali Belajar dan Pembelajaran. IKIP Malang : Pustaka Jaya Kuswardoyo Sosiologi dan Antropologi Sebagai Ilmu tentang Perilaku Sosial dalam Masyarakat. Surakarta:PT Pabelan. Mudjiono dan Dimyati Belajar dan Pembelajaran. Jakarta : Rineka Cipta Munandar, Utami Pengembangan Kreativitas Anak Berbakat. Jakarta : PT Rineka Cipta. Rohani, Ahmad Pengelolaan Pengajaran. Jakarta : PT. Rineka Cipta Sardiman, A.M Interaksi dan Motivasi Belajar Mengajar. Jakarta : PT Rajawali Pers Interaksi dan Motivasi Belajar Mengajar. Jakarta : PT Rajawali Pers. Slameto Belajar dan Faktor-Faktor Yang Mempengaruhinya. Jakarta: Rineka Cipta. Sofyan dan Uno, Hamzah Teori Motivasi dan Aplikasinya dalam Penelitian. Gorontalo : Nurul Janah. 11