DAFTAR ISI... 1 PENDAHULUAN...

Save this PDF as:
Ukuran: px
Mulai penontonan dengan halaman:

Download "DAFTAR ISI... 1 PENDAHULUAN..."

Transkripsi

1 DAFTAR ISI DAFTAR ISI... 1 PENDAHULUAN... 4 A. Latar Belakang... 4 B. Tujuan... 7 C. Ruang Lingkup... 8 D. Manfaat... 8 LANDASAN TEORI... 9 A. Pembelajaran Matematika SD/MI... 9 B. Pembelajaran Bahasa Indonesia (Membaca) SD/MI C. Pembelajaran IPA SD/MI D. Pengukuran, Penilaian, dan Evaluasi Hasil Belajar E. Tes F. Ragam Bentuk Soal Soal Bentuk Uraian Soal Bentuk Objektif G. Teori Respons Butir pada Data Dikotomi H. Teori Respons Butir pada Data Politomi Graded Respons Model (GRM) Partial Credit Model (PCM) Generalized Partial Credit Model (GPCM) I. Kecocokan Model J. Variabel yang Diukur Pengetahuan dan Keterampilan Latar Belakang Peserta Didik, Guru, dan Sekolah K. Strategi Asesmen L. Siklus Asesmen METODOLOGI PENELITIAN A. Target Populasi B. Sampel C. Instrumen Penelitian D. Strategi Pengumpulan Data E. Kerangka Kerja Pengembangan Instrumen Indonesia National Assessment Programme (INAP) 1

2 F. Pelaksanaan Kegiatan Survei Identifikasi Sampel Penggandaan dan Pengiriman Instrumen Pelatihan Administrator Tes Pelaksanaan Pengumpulan Data Pemilahan Data Penskoran Entri Data Teknik Analisis Data KEMAMPUAN MATEMATIKA, MEMBACA, SAINS SISWA DAN KARAKTER BUTIR A. Kemampuan Matematika, Membaca, Sains Terhadap Benchmark Internasional Kemampuan Matematika Siswa Terhadap Benchmark Internasional Kemampuan Bahasa Siswa Terhadap Benchmark Internasional Kemampuan Sains Siswa Terhadap Benchmark Internasional B. Kemampuan Matematika, Membaca, Sains Siswa Deli Serdang Kemampuan Matematika Siswa Deli Serdang Kemampuan Membaca Siswa Deli Serdang Kemampuan Sains Siswa Deli Serdang C. Karakter butir soal INAP nasional dibandingkan dengan soal internasional Karakter Butir Soal INAP Matematika Karakter Butir Soal INAP Membaca Karakter Butir Soal INAP Sains D. Rerata Berdasarkan Level Soal Rerata Soal Matematika Berdasarkan Level Soal Rerata Soal Membaca Berdasarkan Level Soal Rerata Soal Sains Berdasarkan Level Soal E. Contoh butir-butir soal INAP yang setara dengan soal internasional Soal Matematika Soal Membaca Soal Sains LATAR BELAKANG SISWA DAN HASIL SISWA PADA KEMAMPUAN MATEMATIKA, MEMBACA DAN SAINS Indonesia National Assessment Programme (INAP) 2

3 LATAR BELAKANG GURU DAN KEMAMPUAN MATEMATIKA, MEMBACA DAN SAINS KESIMPULAN DAN SARAN A. Kesimpulan B. Saran TINJAUAN PUSTAKA Indonesia National Assessment Programme (INAP) 3

4 BAB I PENDAHULUAN A. Latar Belakang Mutu sumber daya manusia merupakan faktor yang sangat menentukan bagi kemajuan dan kemakmuran suatu bangsa. Pengalaman di banyak negara menunjukkan, mutu sumber daya manusia yang baik lebih penting daripada sumber daya alam yang melimpah. Mutu sumber daya manusia yang baik hanya dapat diwujudkan dengan pendidikan yang baik dan bermutu. Oleh karena itu, upaya peningkatan mutu pendidikan merupakan hal yang tidak dapat ditawar dalam rangka meningkatkan mutu SDM bangsa Indonesia yang siap dan mampu bersaing dalam pergaulan dan pasar kerja global saat ini. Kenyataan di lapangan menunjukkan bahwa permasalahan pendidikan dalam rangka meningkatkan mutu pendidikan memperlihatkan berbagai kendala yang meng-hambat tercapainya tujuan pendidikan seperti diamanatkan dalam Undangundang Nomor 20 Tahun 2003 tentang Sistem Pendidikan Nasional. Rendahnya mutu pendidikan ini dapat terlihat dari berbagai indikator mikro, seperti: hasil studi Trends in International Mathematic and Science Study (TIMSS), yang bertujuan mengetahui perkembangan matematika dan sains peserta didik usia 13 tahun (SMP/MTs kelas VIII) belum menunjukkan prestasi yang memuaskan. Peserta didik Indonesia dalam kemampuan matematika pada tahun 1999 hanya mampu menempati peringkat 34 dari 38 negara, kemampuan dalam bidang sains berada di urutan ke 32. Pada tahun 2003 kemampuan matematika peserta didik Indonesia berada pada peringkat 35 dari 46 negara, sedangkan untuk kemampuan dalam bidang sains berada di urutan ke 37. Selanjutnya, pada tahun 2007 prestasi Indonesia tidak menunjukkan peningkatan yang signifikan, yaitu kemampuan matematika berada pada peringkat 36 dari 48 negara dan kemampuan sains berada pada peringkat 35. Keprihatinan yang sama dapat dilihat dalam laporan studi Programme for International Student Assessment (PISA). Pada tahun 2000 prestasi literasi membaca (reading literacy) bagi peserta didik Indonesia usia 15 tahun berada pada Indonesia National Assessment Programme (INAP) 4

5 peringkat 39 dari 41 negara, prestasi literasi matematika (mathematical literacy) berada pada peringkat 39, dan prestasi literasi sains (scientific literacy) berada pada peringkat 38. Pada tahun 2003, untuk literasi membaca peserta didik Indonesia berada di peringkat 39 dari 40 negara peserta, literasi matematika berada di peringkat 38, dan untuk literasi sains berada pada peringkat 38. Pada tahun 2006 prestasi literasi membaca peserta didik Indonesia berada pada peringkat 48 dari 56 negara, literasi matematika berada pada peringkat 50 dari 57 negara, dan literasi sains berada pada peringkat 50 dari 57 negara. Hasil studi PIRLS (Progress in International Reading Literacy Study) tahun 2006 dalam bidang membaca pada anak-anak kelas IV sekolah dasar di seluruh dunia di bawah koordinasi The International Association for the Evaluation of Educational Achievement (IEA) yang diikuti 45 negara/negara bagian, baik berasal dari negara maju maupun dari negara berkembang, memperlihatkan bahwa peserta didik Indonesia berada pada peringkat ke 41. Secara nasional, mutu prestasi peserta didik kelas IX SMP/MTs, kelas XII SMA/MA berdasarkan ujian nasional (UN) masih sangat bervariasi dilihat dari ratarata nasional setiap mata pelajaran 3 tahun terakhir. Hasil UN baik pada tahun 2006, 2007, maupun 2008 menunjukkan rentang nilai terendah dan tertinggi masih di atas 9 dari skala 10; yang menunjukkan bahwa perbedaan peserta didik kemampuan terendah dan kemampuan tertinggi masih terlampau jauh. Standar deviasi hasil UN dari tahun ke tahun pun menunjukkan peningkatan yang berarti keragaman nilai semakin bervariasi. Sebagai contoh mata pelajaran matematika; pada tahun 2006 untuk jenjang SMP/MTs standar deviasi meningkat dari 1,10 menjadi 1,61 di tahun 2008, dan untuk jenjang SMA/MA, standar deviasi meningkat dari 0,90 di tahun 2006 menjadi 1,58 di tahun Keberagaman ini menunjukkan lebarnya penyebaran kemampuan matematika peserta didik di tahun 2008 dibandingkan tahun Rerata nilai matematika dan bahasa Indonesia di tingkat SMP/MTs-pun menunjukkan trend penurunan. Dalam rangka meningkatkan mutu pendidikan perlu dilakukan pemantauan mutu pendidikan secara periodik dan sistematik agar diperoleh hasil yang lebih menyeluruh dari permasalahan yang dihadapi, sehingga kebijakan yang diambil Indonesia National Assessment Programme (INAP) 5

6 dapat sinkron dengan permasalahan yang ada dan dapat menjawab pertanyaan yang sering muncul sehubungan dengan rendahnya mutu pendidikan di Indonesia. Hasil pemantauan mutu yang dilakukan secara periodik dan sistematik ini juga dapat mendiagnosa sehat tidaknya sistem pendidikan yang sedang berlaku, baik di tingkat nasional maupun provinsi/kabupaten/ kota. Selama ini di Indonesia belum ada mekanisme yang terlembaga yang memantau mutu secara periodik dan sistematik. Di negara maju sistem pemantauan mutu sudah berjalan dengan baik dan terlembaga, seperti di Amerika (NAEP), juga di negara berkembang telah terbukti bahwa asesmen yang terlembaga dan dilaksanakan secara profesional sangat berguna untuk menyusun kebijakan dalam rangka meningkatkan mutu, seperti di Chili. Berdasarkan kenyataan ini, mengembangkan sistem pemantauan melalui asesmen secara nasional yang terlembaga bagi Indonesia sangatlah penting, mengingat Indonesia sangat besar dan heterogen dilihat dari berbagai aspek. Dengan adanya sistem pemantauan terlembaga yang dilakukan secara periodik dan sistematik, dapat dikembangkan kebijakan yang tepat sesuai hasil diagnosa pemantauan ini, kemudian dapat dibuat laporan secara berkala, mana yang berhasil dan mana yang tidak berhasil sebagai akuntabilitas kepada publik. Dalam arti pendidikan diarahkan kepada sistem yang transparan, akuntabel, dan demokratis. Sehubungan dengan hal tersebut, Pusat Penilaian Pendidikan, Balitbang Kemdik-nas membentuk sistem pemantauan mutu yang terlembaga di tingkat provinsi dan kabupaten/kota. Pemantauan mutu dilakukan melalui survei yang disebut Indonesia National Assessment Programme (INAP). Survei ini bersifat longitudinal untuk memantau mutu pendidikan secara nasional pada satuan pendidikan SD/MI (kelas I VI), SMP/MTs (kelas VII IX), dan SMA/MA (kelas X XII). Berdasarkan survei longitudinal ini diperoleh data tentang mutu pendidikan yang valid, tidak hanya menggambarkan pencapaian kemampuan peserta didik, tetapi juga faktor-faktor yang mempengaruhinya. Pada implementasinya, survei INAP dilakukan bertahap dengan membidik target kelas yang berbeda di setiap tahunnya hingga satu kurun siklus pelaksanaan. Diharapkan melalui INAP, berbagai pihak yang terlibat dalam pengambilan keputusan mengenai pendidikan, antara lain Kementerian Pendidikan Nasional, Indonesia National Assessment Programme (INAP) 6

7 Kementerian Agama, Bappenas, Kementerian Keuangan, Pemerintah Daerah, Dinas Pendidikan Kabupaten/Kota, DPR/DPRD, Perguruan Tinggi, dan Lembaga Swadaya Masyarakat akan memperoleh informasi secara berkala, sistematis, dan ilmiah. Permasalahan yang dapat dirumuskan dari uraian tersebut adalah: (1) belum adanya sistem pemantauan yang terlembaga di Indonesia. Kalaupun ada, sifatnya adalah adhoc; (2) kurangnya kemampuan Provinsi, Kabupaten/Kota untuk melakukan survei dalam rangka memantau mutu pendidikan, (3) belum adanya informasi secara berkala dan terbuka kepada masyarakat luas mengenai perkembangan mutu pendidikan, baik di tingkat Provinsi, maupun Kabupaten/ Kota, terlebih lagi dalam hubungannya dengan kebijakan yang sudah diambil (transparansi dan akuntabilitas), dan (4) belum disusunnya pengambilan kebijakan yang berdasarkan hasil analisis terhadap data atau informasi yang diperoleh dari hasil pemantauan mutu. B. Tujuan Tujuan INAP adalah melakukan pemantauan mutu pendidikan untuk: 1. Membentuk sistem pemantauan mutu pendidikan di tingkat Provinsi dan Kabupaten/Kota yang terlembaga. 2. Meningkatkan kemampuan provinsi, kabupaten/kota untuk melakukan survei dalam rangka memantau mutu pendidikan. 3. Membandingkan tingkat keberhasilan program pendidikan (prestasi) di tingkat Provinsi dan Kabupaten/Kota 4. Mengidentifikasi domain konten dan kognitif yang belum dikuasai/lemah. 5. Mengidentifikasi variabel latar belakang peserta didik, guru, dan sekolah yang menentukan keberhasilan peserta didik. 6. Memantau tingkat ketercapaian pembelajaran dari waktu ke waktu secara periodik dan sistematik. 7. Menyusun laporan tingkat ketercapaian pembelajaran pada tingkat Provinsi dan Kabupaten/Kota. Indonesia National Assessment Programme (INAP) 7

8 C. Ruang Lingkup Ruang lingkup survei ini meliputi: 1. Objek survei ini adalah peserta didik kelas V SD/MI Negeri dan Swasta di 2 kabupaten di 2 provinsi (Deli Serdang, Sumatera Utara dan Karawang, Jawa Barat) 2. Kemampuan yang diukur adalah kemampuan matematika, membaca, dan IPA. 3. Faktor-faktor yang mempengaruhi kemampuan peserta didik baik dari latar belakang peserta didik, guru, maupun sekolah dijaring melalui angket yang diberikan kepada peserta didik, guru, dan kepala sekolah. D. Manfaat Manfaat dari hasil analisis terhadap data atau informasi INAP adalah: 1. Orang tua dapat mengetahui ketercapaian prestasi peserta didik serta faktorfaktor yang mempengaruhinya. 2. Guru dapat memanfaatkan informasi untuk perbaikan proses pembelajaran. 3. Kepala sekolah dapat memanfaatkan informasi untuk merencanakan dan memperbaiki program manajemen sekolah, termasuk kegiatan pembelajaran. 4. Pemerintah (Pusat, Provinsi dan Kabupaten/Kota), Kemdikbud (Dikdasmen, PMPTK, LPMP), Kementerian Agama, Bappenas, Kementerian Keuangan, Dinas Pendidikan Kabupaten/Kota, Parlemen, Perguruan Tinggi, Pengembang Kurikulum, dan lain-lain akan dapat memanfaatkan informasi dari INAP yang tersedia secara berkala, sistematis, dan ilmiah. 5. Masyarakat secara luas dapat memperoleh informasi secara berkala dan terbuka mengenai perkembangan mutu pendidikan baik di tingkat nasional maupun provinsi, atau kabupaten/kota, terlebih lagi dalam hubungannya dengan kebijakan yang sudah diambil (transparansi dan akuntabilitas). Indonesia National Assessment Programme (INAP) 8

9 BAB II LANDASAN TEORI A. Pembelajaran Matematika SD/MI Matematika merupakan ilmu universal yang mendasari perkembangan teknologi modern, mempunyai peran penting dalam berbagai disiplin ilmu dan memajukan daya pikir manusia. Matematika yang diajarkan di jenjang persekolahan disebut matematika sekolah. Matematika sekolah atau School Mathematics adalah unsur atau bagian dari matematika yang dipilih berdasarkan dan berorientasi kepada kepentingan kependidikan dan perkembangan IPTEK (R.Soedjadi, 2000:3). Perkembangan pesat di bidang teknologi informasi dan komunikasi dewasa ini dilandasi oleh perkembangan matematika di bidang teori bilangan, aljabar, analisis, teori peluang, dan matematika diskrit. Untuk menguasai dan mencipta teknologi di masa depan diperlukan penguasaan matematika yang kuat sejak dini. Tujuan diberikannya matematika di sekolah menurut Moch. Masykur dan Abdul Halim (2007:36) adalah untuk mempersiapkan siswa agar bisa menghadapi perubahan kehidupan dan dunia yang selalu berkembang dan sarat perubahan, melalui latihan bertindak atas dasar kemampuan berpikir logis, analitis, sistematis, kritis, dan kreatif, serta kemampuan bekerjasama. Kompetensi tersebut diperlukan agar siswa dapat memiliki kemampuan memperoleh, mengelola, dan memanfaatkan informasi untuk bertahan hidup pada keadaan yang selalu berubah, tidak pasti, dan kompetitif. Pembelajaran matematika adalah proses pemberian pengalaman belajar kepada siswa melalui serangkaian kegiatan yang terencana sehingga siswa memperoleh kompetensi tentang bahan matematika yang dipelajari. Tujuan umum pembelajaran matematika di sekolah adalah penataan nalar, pembentukan sikap siswa dan keterampilan dalam penerapan ilmu matematika. Mata pelajaran Matematika pada satuan pendidikan SD/MI meliputi aspek-aspek sebagai berikut: (1) Bilangan, (2) Geometri dan pengukuran, dan (3) Pengolahan data. Indonesia National Assessment Programme (INAP) 9

10 Kurikulum yang diterapkan dalam pembelajaran matematika di sekolah mulai tahun pelajaran 2006/2007 adalah Kurikulum Tingkat Satuan Pendidikan (KTSP). Berdasarkan Peraturan Pemerintah Republik Indonesia Nomor 19 Tahun 2005 tentang Standar Nasional Pendidikan Bab 1 Pasal 1, KTSP adalah kurikulum operasional yang disusun oleh dan dilaksanakan di masing-masing satuan pendidikan. KTSP dibuat berdasarkan Standar Isi (SI) dan Standar Kompetensi Lulusan (SKL). Penyusunan kurikulum pada tingkat satuan pendidikan dasar dan menengah berpedoman pada panduan yang disusun oleh Badan Standar Nasional Pendidikan (BSNP). KTSP memberi keleluasaan kepada sekolah untuk mengembangkan kurikulum sesuai dengan satuan pendidikan, potensi daerah/karakteristik daerah, sosial budaya masyarakat setempat, dan peserta didik. Guru diberi otonomi dalam menjabarkan kurikulum dan siswa sebagai subjek dalam proses belajar mengajar. Guru leluasa memilih bahan ajar yang sesuai dengan kondisi sekolah dan kemampuan peserta didiknya. Selain itu, siswa diharapkan dapat mengembangkan potensinya sesuai dengan kemampuan, kebutuhan, dan minatnya. Selain itu, implementasi KTSP diharapkan dapat memenuhi standarisasi evaluasi belajar siswa. Berikut standar kompetensi dan kompetensi dasar pada jenjang SD/MI yang menjadi arah dan landasan untuk mengembangkan materi pokok, kegiatan pembelajaran, dan indikator pencapaian kompetensi untuk penilaian. Kelas I, Semester 1 Standar Kompetensi Bilangan 1. Melakukan penjumlahan dan pengurangan bilangan sampai 20 Kompetensi Dasar 1.1 Membilang banyak benda 1.2 Mengurutkan banyak benda 1.3 Melakukan penjumlahan dan pengurangan bilangan sampai Menyelesaikan masalah yang berkaitan dengan penjumlahan dan pengurangan sampai 20 Indonesia National Assessment Programme (INAP) 10

11 Standar Kompetensi Kompetensi Dasar Geometri dan Pengukuran 2.1 Menentukan waktu (pagi, siang, malam), hari, 2. Menggunakan dan jam (secara bulat) pengukuran waktu dan 2.2 Menentukan lama suatu kejadian berlangsung panjang 2.3 Mengenal panjang suatu benda melalui kalimat sehari-hari (pendek, panjang) dan membandingkannya 2.4 Menyelesaikan masalah yang berkaitan dengan waktu dan panjang 3. Mengenal beberapa 3.1 Mengelompokkan berbagai bangun ruang bangun ruang sederhana (balok, prisma, tabung, bola, dan kerucut) 3.2 Menentukan urutan benda-benda ruang yang sejenis menurut besarnya Kelas I, Semester 2 Standar kompetensi Kompetensi Dasar Bilangan 4.1 Membilang banyak benda 4. Melakukan penjumlahan 4.2 Mengurutkan banyak benda dan pengurangan bilangan 4.3 Menentukan nilai tempat puluhan dan satuan sampai dua angka dalam 4.4 Melakukan penjumlahan dan pengurangan pemecahan masalah bilangan dua angka 4.5 Menggunakan sifat operasi pertukaran dan pengelompokan 4.6 Menyelesaikan masalah yang melibatkan penjumlahan dan pengurangan bilangan dua angka Geometri dan Pengukuran 5.1 Membandingkan berat benda (ringan, berat) 5. Menggunakan pengukuran 5.2 Menyelesaikan masalah yang berkaitan dengan berat berat benda 6. Mengenal bangun datar 6.1 Mengenal segitiga, segi empat, dan lingkaran sederhana 6.2 Mengelompokkan bangun datar menurut bentuknya Indonesia National Assessment Programme (INAP) 11

12 Kelas II, Semester 1 Standar kompetensi Kompetensi Dasar Bilangan 1.1 Membandingkan bilangan sampai Melakukan penjumlahan 1.2 Mengurutkan bilangan sampai 500 dan pengurangan bilangan 1.3 Menentukan nilai tempat ratusan, puluhan, dan sampai 500 satuan 1.4 Melakukan penjumlahan dan pengurangan bilangan sampai 500 Geometri dan Pengukuran 2.1 Menggunakan alat ukur waktu dengan satuan 2. Menggunakan pengukuran jam waktu, panjang dan berat dalam pemecahan masalah Kelas II, Semester 2 Standar Kompetensi Bilangan 3. Melakukan perkalian dan pembagian bilangan sampai dua angka Geometri dan Pengukuran 4. Mengenal unsur-unsur bangun datar sederhana Kelas III, Semester 1 Standar Kompetensi Bilangan 1. Melakukan operasi hitung bilangan sampai tiga angka 2.2 Menggunakan alat ukur panjang tidak baku dan baku (cm, m) yang sering digunakan 2.3 Menggunakan alat ukur berat 2.4 Menyelesaikan masalah yang berkaitan dengan berat benda Kompetensi Dasar 3.1 Melakukan perkalian bilangan yang hasilnya bilangan dua angka 3.2 Melakukan pembagian bilangan dua angka 3.3 Melakukan operasi hitung campuran 4.1 Mengelompokkan bangun datar 4.2 Mengenal sisi-sisi bangun datar 4.3 Mengenal sudut-sudut bangun datar Kompetensi Dasar 1.1 Menentukan letak bilangan pada garis bilangan 1.2 Melakukan penjumlahan dan pengurangan tiga angka 1.3 Melakukan perkalian yang hasilnya bilangan Indonesia National Assessment Programme (INAP) 12

13 Standar Kompetensi Geometri dan Pengukuran 2. Menggunakan pengukuran waktu, panjang dan berat dalam pemecahan masalah Kompetensi Dasar tiga angka dan pembagian bilangan tiga angka 1.4 Melakukan operasi hitung campuran 1.5 Memecahkan masalah perhitungan termasuk yang berkaitan dengan uang 2.1 Memilih alat ukur sesuai dengan fungsinya (meteran, timbangan, atau jam) 2.2 Menggunakan alat ukur dalam pemecahan masalah 2.3 Mengenal hubungan antar satuan waktu, antar satuan panjang, dan antar satuan berat Kelas III, Semester 2 Standar Kompetensi Bilangan 3. Memahami pecahan sederhana dan penggunaannya dalam pemecahan masalah Geometri dan Pengukuran 4. Memahami unsur dan sifat-sifat bangun datar sederhana 5. Menghitung keliling, luas persegi dan persegi panjang, serta penggunaannya dalam pemecahan masalah Kompetensi Dasar 3.1 Mengenal pecahan sederhana 3.2 Membandingkan pecahan sederhana 3.3 Memecahkan masalah yang berkaitan dengan pecahan sederhana 4.1 Mengidentifikasi berbagai bangun datar sederhana menurut sifat atau unsurnya 4.2 Mengidentikasi berbagai jenis dan besar sudut 5.1 Menghitung keliling persegi dan persegi panjang 5.2 Menghitung luas persegi dan persegi panjang 5.3 Menyelesaikan masalah yang berkaitan dengan keliling, luas persegi dan persegi panjang Indonesia National Assessment Programme (INAP) 13

14 Kelas IV, Semester 1 Standar Kompetensi Kompetensi Dasar Bilangan 1. Memahami dan menggunakan sifat-sifat operasi 1.2 Mengurutkan bilangan 1.1 Mengidentifikasi sifat-sifat operasi hitung hitung bilangan dalam 1.3 Melakukan operasi perkalian dan pembagian pemecahan masalah 1.4 Melakukan operasi hitung campuran 1.5 Melakukan penaksiran dan pembulatan 1.6 Memecahkan masalah yang melibatkan uang 2. Memahami dan menggunakan faktor dan keli-patan 2.2 Menentukan kelipatan dan faktor bilangan 2.1 Mendeskripsikan konsep faktor dan kelipatan dalam pemecahan masalah 2.3 Menentukan kelipatan persekutuan terkecil (KPK) dan faktor persekutuan terbesar (FPB) 2.4 Menyelesaikan masalah yang berkaitan dengan KPK dan FPB Geometri dan Pengukuran 3.1 Menentukan besar sudut dengan satuan tidak 3. Menggunakan pengukuran baku dan satuan derajat sudut, panjang, dan berat 3.2 Menentukan hubungan antar satuan waktu, dalam pemecahan masalah antar satuan panjang, dan antar satuan berat 3.3 Menyelesaikan masalah yang berkaitan dengan satuan waktu, panjang dan berat 3.4 Menyelesaikan masalah yang berkaitan dengan satuan kuantitas 4. Menggunakan konsep 4.1 Menentukan keliling dan luas jajargenjang dan keliling dan luas bangun datar segitiga sederhana dalam pemecahan 4.2 Menyelesaikan masalah yang berkaitan dengan masalah keliling dan luas jajargenjang dan segitiga Indonesia National Assessment Programme (INAP) 14

15 Kelas IV, Semester 2 Standar Kompetensi Bilangan 5. Menjumlahkan dan mengurangkan bilangan bulat 6. Menggunakan pecahan dalam pemecahan masalah 7. Menggunakan lambang bilangan Romawi Geometri dan Pengukuran 8. Memahami sifat bangun ruang sederhana dan hubungan antar bangun datar Kompetensi Dasar 5.1 Mengurutkan bilangan bulat 5.2 Menjumlahkan bilangan bulat 5.3 Mengurangkan bilangan bulat 5.3 Melakukan operasi hitung campuran 6.1 Menjelaskan arti pecahan dan urutannya 6.2 Menyederhanakan berbagai bentuk pecahan 6.3 Menjumlahkan pecahan 6.4 Mengurangkan pecahan 6.5 Menyelesaikan masalah yang berkaitan dengan pecahan 7.1 Mengenal lambang bilangan Romawi 7.2 Menyatakan bilangan cacah sebagai bilangan Romawi dan sebaliknya 8.1 Menentukan sifat-sifat bangun ruang sederhana 8.2 Menentukan jaring-jaring balok dan kubus 8.3 Mengidentifikasi benda-benda dan bangun datar simetris 8.4 Menentukan hasil pencerminan suatu bangun datar B. Pembelajaran Bahasa Indonesia (Membaca) SD/MI. Bahasa Indonesia sebagai bahasa nasional dan bahasa negara, memiliki peran sentral dalam perkembangan intelektual, sosial dan emosional peserta didik dan merupakan penunjang keberhasilan dalam mempelajari semua bidang studi. Pembelajaran bahasa diharapkan dapat membantu peserta didik mengenal dirinya sendiri, budayanya dan budaya orang lain, mengemukakan gagasan dan perasaan, berpartisipasi dalam masyarakat yang menggunakan bahasa tersebut, Indonesia National Assessment Programme (INAP) 15

16 dan menemukan serta menggunakan kemampuan analisis dan imajinatif yang ada dalam dirinya. Pembelajaran bahasa Indonesia diartikan untuk meningkatkan kemampuan peserta didik untuk berkomunikasi dalam bahasa Indonesia dengan baik dan benar, baik secara lisan maupun tertulis, serta menumbuhkan apresiasi terhadap hasil karya kesusastraan masyarakat Indonesia. Standar Kompetensi mata pelajaran bahasa Indonesia di sekolah dasar merupakan kualifikasi kemampuan minimal peserta didik yang menggambarkan penguasaan pengetahuan, keterampilan berbahasa dan sikap positif terhadap bahasa dan sastra Indonesia. Standar Kompetensi ini merupakan dasar bagi peserta didik untuk memahami dan merespon situasi lokal, regional, nasional dan global. Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional siswa dan merupakan modal utama sebagai penunjang keberhasilan dalam mempelajari semua bidang studi. Pembelajaran adalah suatu proses belajar yang merupakan suatu bentuk pengalaman belajar untuk menguasai sesuatu materi pembelajaran. Dalam pembelajarannya menggunakan keterampilan proses untuk mencapai tujuan pembelajaran. Sehingga pada akhirnya, pembelajaran bahasa diharapkan membantu peserta didik mengenal dirinya, budayanya, dan budaya orang lain, mengemukakan gagasan dan perasaan, berpartisipasi dalam masyarakat yang menggunakan bahasa tersebut, dan menemukan serta menggunakan kemampuan analitis dan imaginatif yang ada dalam dirinya. Kemampuan Bahasa Indonesia di Sekolah Dasar mengarahkan siswa agar dapat berkomunikasi dalam bahasa Indonesia dengan baik dan benar, baik secara lisan maupun tulis, serta menumbuhkan apresiasi terhadap hasil karya kesastraan manusia Indonesia. Hal ini merujuk kepada fungsi dari bahasa Indonesia sebagai bahasa nasional dan bahasa negara yang merupakan suatu hasil karya cipta intelektual produk budaya pada fungsi bahasa sebagai: Sarana pembinaan dan persatuan bangsa. Sarana penyebarluasan pemakaian bahasa Indonesia yang baik untuk berbagai keperluan masalah. Sarana pengembangan penalaran. Indonesia National Assessment Programme (INAP) 16

17 Sarana pemhaman berbagai budaa Indonesia melalui khazanah kesusastraan Indonesia. Sarana peningkatan pengetahuan dan keterampilan dalam rangka pelestarian dan pengembangan budaya. Sarana peningkatan pengetahuan dan keterampilan untuk meraih dan mengembangkan ilmu pengetahuan, teknologi, dan seni. Dalam Kurikulum Tingkat Satuan Pendidikan dijelaskan tentang tujuan adanya pembelajaran Bahasa Indonesia, yakni bertujuan agar siswa memiliki kemampuan sebagai berikut. 1. Berkomunikasi secara efektif dan efisien sesuai dengan etika yang berlaku, baik secara lisan maupun tulis 2. Menghargai dan bangga menggunakan bahasa Indonesia sebagai bahasa persatuan dan bahasa negara 3. Memahami bahasa Indonesia dan menggunakannya dengan tepat dan kreatif untuk berbagai tujuan 4. Menggunakan bahasa Indonesia untuk meningkatkan kemampuan intelektual, serta kematangan emosional dan sosial 5. Menikmati dan memanfaatkan karya sastra untuk memperluas wawasan, memperhalus budi pekerti, serta meningkatkan pengetahuan dan kemampuan berbahasa 6. Menghargai dan membanggakan sastra Indonesia sebagai khazanah budaya dan intelektual manusia Indonesia. Bahan ajar bahasa Indonesia di sekolah dasar mencakup komponen kemampuan berbahasa dan kemampuan bersastra yang meliputi aspek-aspek sebagai berikut: 1. Mendengarkan Materi pokok keterampilan menyimak: menyimak berita, menyimak petunjuk, menyimak dialog, menyimak pantun, menyimak drama, menyimak cerita anak, dan menyimak cerita rakyat. Indonesia National Assessment Programme (INAP) 17

18 2. Berbicara Materi pokok keterampilan berbicara: bercerita, berdialog, berpidato, berpuisi, menjelaskan sesuatu, menanggapi (memuji/mengkritik), berpantun, dan wawancara. 3. Membaca Materi pokok keterampilan membaca: membaca nyaring, membaca intensif, membaca memindai, membaca dongeng, membaca kamus, membaca puisi, dan membaca pantun. 4. Menulis. Materi pokok keterampilan menulis: menulis paragraf, menulis puisi, mengarang, menulis cerita, menulis drama, menulis pidato, menulis pantun, menulis pengumuman, menulis laporan, parafrase, meringkas, mengisi formulir, dan menulis surat. Standarkompetensi dan kompetensi dasar pada jenjang SD/MI yang menjadi arah dan landasan untuk mengembangkan materi pokok, kegiatan pembelajaran, dan indikator pencapaian kompetensi untuk penilaian 1. Kelas 1 (satu) Semester I Standard Kompetensi Mendengarkan Memahami bunyi bahasa, perintah, dan dongeng yang dilisankan Berbicara Mengungkapkan pikiran, Kompetensi Dasar 1. Membedakan berbagai bunyi bahasa 2. Melaksanakan sesuatu sesuai dengan perintah atau petunjuk sederhana 3. Menyebutkan tokoh-tokoh dalam cerita 1. Memperkenalkan diri sendiri dengan kalimat sederhana dan Indonesia National Assessment Programme (INAP) 18

19 perasaan, dan informasi, secara lisan dengan perkenalan dan tegur sapa, pengenalan benda dan fungsi anggota tubuh, dan deklamasi Membaca Memahami teks pendek dengan membaca nyaring Menulis Menulis permulaan dengan menjiplak, menebalkan, mencontoh, melengkapi, dan menyalin bahasa yang santun 2. Menyapa orang lain dengan menggunakan kalimat sapaan yang tepat dan bahasa yang santun 3. Mendeskipsikan benda-benda di sekitar dan fungsi anggota tubuh dengan kalimat sederhana 4. Mendeklamasikan puisi anak dengan lafal dan intonasi yang sesuai 1. Membaca nyaring suku kata dan kata dengan lafal yang tepat 2. Membaca nyaring kalimat sederhana dengan lafal dan intonasi yang tepat 1. Menjiplak berbagai bentuk gambar, lingkaran, dan bentuk huruf 2. Menebalkan berbagai bentuk gambar, lingkaran, dan bentuk huruf 3. Mencontoh huruf, kata, atau kalimat sederhana dari buku atau papan tulis dengan benar 4. Melengkapi kalimat yang belum selesai berdasarkan gambar 5. Menyalin puisi anak sederhana dengan huruf lepas Semester II Standard Kompetensi Mendengarkan Memahami wacana lisan tentang Kompetensi Dasar 1. Mengulang deskripsi tentang benda-benda di sekitar Indonesia National Assessment Programme (INAP) 19

20 deskripsi benda-benda di sekitar dan dongeng Berbicara Mengungkapkan pikiran, perasaan, dan informasi secara lisan dengan gambar, percakapan sederhana, dan dongeng Membaca Memahami teks pendek dengan membaca lancar dan membaca puisi anak Menulis Menulis permulaan dengan huruf tegak bersambung melalui kegiatan dikte dan menyalin 2. Menyebutkan isi dongeng 1. Menjelaskan isi gambar tunggal atau gambar seri sederhana dengan bahasa yang mudah dimengerti 2. Melakukan percakapan sederhana dengan menggunakan kalimat dan kosakata yang sudah dikuasai 3. Menyampaikan rasa suka atau tidak suka tentang suatu hal atau kegiatan dengan alasan sederhana 4. Memerankan tokoh dongeng atau cerita rakyat yang disukai dengan ekspresi yang sesuai 1. Membaca lancar beberapa kalimat sederhana yang terdiri atas 3-5 kata dengan intonasi yang tepat 2. Membaca puisi anak yang terdiri atas 2-4 baris dengan lafal dan intonasi yang tepat 1. Menulis kalimat sederhana yang didiktekan guru dengan huruf tegak bersambung 2. Menyalin puisi anak dengan huruf tegak bersambung Indonesia National Assessment Programme (INAP) 20

21 2. Kelas 2 (dua) Semester I Standard Kompetensi Mendengarkan Memahami teks pendek dan puisi anak yang dilisankan Berbicara Mengungkapkan pikiran, perasaan, dan informasi, secara lisan dengan perkenalan dan tegur sapa, pengenalan benda dan fungsi anggota tubuh, dan deklamasi Membaca Memahami teks pendek dengan membaca lancar dan membaca puisi anak Menulis Menulis permulaan melalui kegiatan melengkapi cerita dan dikte Kompetensi Dasar 1. Menyebutkan kembali dengan kata-kata atau kalimat sendiri isi teks pendek 2. Mendeskripsikan isi puisi 1. Bertanya kepada orang lain dengan menggunakan pilihan kata yang tepat dan santun berbahasa 2. Menceritakan kegiatan seharihari dengan bahasa yang mudah dipahami orang lain 3. Mendeklamasikan puisi dengan ekspresi yang tepat 1. Menyimpulkan isi teks pendek (10-15 kalimat) yang dibaca dengan membaca lancar 2. Menjelaskan isi puisi anak yang dibaca 1. Melengkapi cerita sederhana dengan kata yang tepat 2. Menulis kalimat sederhana yang didiktekan guru dengan menggunakan huruf tegak bersambung dan memperhatikan penggunaan huruf kapital dan tanda titik Indonesia National Assessment Programme (INAP) 21

22 Semester II Standard Kompetensi Mendengarkan Memahami pesan pendek dan dongeng yang dilisankan Berbicara Mengungkapkan secara lisan beberapa informasi dengan mendeskripsikan benda dan bercerita Membaca Memahami ragam wacana tulis dengan membaca nyaring dan membaca dalam hati Menulis Menulis permulaan dengan mendeskripsikan benda di sekitar dan menyalin puisi anak Kompetensi Dasar 1. Menyampaikan pesan pendek yang didengarnya kepada orang lain 2. Menceritakan kembali isi dongeng yang didengarnya 1. Mendeskripsikan tumbuhan atau binatang di sekitar sesuai ciri-cirinya dengan menggunakan kalimat yang mudah dipahami orang lain 2. Menceritakan kembali cerita anak yang didengarkan dengan menggunakan kata-kata sendiri 1. Membaca nyaring teks (15-20 kalimat) dengan memperhatikan lafal dan intonasi yang tepat 2. Menyebutkan isi teks agak panjang (20-25 kalimat) yang dibaca dalam hati 1. Mendeskripsikan tumbuhan atau binatang di sekitar secara sederhana dengan bahasa tulis 2. Menyalin puisi anak dengan huruf tegak bersambung yang rapi Indonesia National Assessment Programme (INAP) 22

23 3. Kelas 3 (tiga) Semester I Standard Kompetensi Mendengarkan Memahami penjelasan tentang petunjuk dan cerita anak yang dilisankan Berbicara Mengungkapkan pikiran, perasaan, pengalaman, dan petunjuk dengan bercerita dan memberikan tanggapan/saran Membaca Memahami teks dengan membaca nyaring, membaca intensif, dan membaca dongengi Kompetensi Dasar 1. Melakukan sesuatu berdasarkan penjelasan yang disampaikan secara lisan 2. Mengomentari tokoh-tokoh cerita anak yang disampaikan secara lisan 1. Menceritakan pengalaman yang mengesankan dengan menggunakan kalimat yang runtut dan mudah dipahami 2. Menjelaskan urutan membuat atau melakukan sesuatu dengan kalimat yang runtut dan mudah dipahami 3. Memberikan tanggapan dan saran sederhana terhadap suatu masalah dengan menggunakan kalimat yang runtut dan pilihan kata yang tepat 1. Membaca nyaring teks (20-25 kalimat) dengan lafal dan intonasi yang tepat 2. Menjelaskan isi teks ( kata) melalui membaca intensif 3. Menceritakan isi dongeng yang dibaca Indonesia National Assessment Programme (INAP) 23

24 Menulis Mengungkapkan pikiran, perasaan, dan informasi dalam bentuk paragraf dan puisi 1. Menyusun paragraf berdasarkan bahan yang tersedia dengan memperhatikan penggunaan ejaan 2. Melengkapi puisi anak berdasarkan gambar Semester II Standard Kompetensi Mendengarkan Memahami cerita dan teks drama anak yang dilisankan Berbicara Mengungkapkan pikiran, perasaan, dan pengalaman secara lisan dengan bertelepon dan bercerita Membaca Memahami teks dengan membaca intensif ( kata) dan membaca puisi Kompetensi Dasar 1. Memberikan tanggapan sederhana tentang cerita pengalaman teman yang didengarnya 2. Menirukan dialog dengan ekspresi yang tepat dari pembacaan teks drama anak yang didengarnyan 1. Melakukan percakapan melalui telepon/alat komunikasi sederhana dengan menggunakan kalimat ringkas 2. Menceritakan peristiwa yang pernah dialami, dilihat, atau didengar 1. Menjawab dan atau mengajukan pertanyaan tentang isi teks agak panjang ( kata) yang dibaca secara intensif 2. Membaca puisi dengan lafal, Indonesia National Assessment Programme (INAP) 24

25 intonasi, dan ekspresi yang tepat Menulis Mengungkapkan pikiran, perasaan, dan informasi dalam karangan sederhana dan puisi 1. Menulis karangan sederhana berdasarkan gambar seri menggunakan pilihan kata dan kalimat yang tepat dengan memperhatikan penggunaan ejaan, huruf kapital, dan tanda titik 2. Menulis puisi berdasarkan gambar dengan pilihan kata yang menarik 4. Kelas 4 (Empat) Semester I Standard Kompetensi Mendengarkan Mendengarkan penjelasan tentang petunjuk denah dan simbol daerah/lambang korps Berbicara Mendeskripsikan secara lisan tempat sesuai denah dan petunjuk penggunaan suatu alat Kompetensi Dasar 1. Membuat gambar/denah berdasarkan penjelasan yang didengar 2. Menjelaskan kembali secara lisan atau tulis penjelasan tentang simbol daerah/lambang korps 1. Mendeskripsikan tempat sesuai dengan denah atau gambar dengan kalimat yang runtut 2. Menjelaskan petunjuk penggunaan suatu alat dengan bahasa yang baik dan benar Indonesia National Assessment Programme (INAP) 25

26 Membaca Memahami teks agak panjang ( kata), petunjuk pemakaian, makna kata dalam kamus/ensiklopedii Menulis Mengungkapkan pikiran, perasaan, dan informasi secara tertulis dalam bentuk percakapan, petunjuk, cerita, dan surat 1. Menemukan pikiran pokok teks agak panjang ( kata) dengan cara membaca sekilas 2. Melakukan sesuatu berdasarkan petunjuk pemakaian yang dibaca 3. Menemukan makna dan informasi secara tepat dalam kamus/ensiklopedi melalui membaca memindai 1. Melengkapi percakapan yang belum selesai dengan memperhatikan penggunaan ejaan (tanda titik dua dan tanda petik) 2. Menulis petunjuk untuk melakukan sesuatu atau penjelasan tentang cara membuat sesuatu 3. Melengkapi bagian cerita yang hilang (rumpang) dengan menggunakan kata/kalimat yang tepat sehingga menjadi cerita yang padu 4. Menulis surat untuk teman sebaya tentang pengalaman atau cita-cita dengan bahasa yang baik dan benar dan memperhatikan penggunaan ejaan (huruf besar, tanda titik, Indonesia National Assessment Programme (INAP) 26

27 tanda koma, dll.) Semester II Standard Kompetensi Mendengarkan Mendengarkan pengumuman dan pembacaan pantun Berbicara Mengungkapkan pikiran, perasaan, dan informasi dengan berbalas pantun dan bertelepon Membaca Memahami teks melalui membaca intensif, membaca nyaring, dan membaca pantun Menulis Mengungkapkan pikiran, perasaan, dan informasi secara tertulis dalam bentuk karangan, pengumuman, dan pantun anak Kompetensi Dasar 1. Menyampaikan kembali isi pengumuman yang dibacakan 2. Menirukan pembacaan pantun anak dengan lafal dan intonasi yang tepat 1. Berbalas pantun dengan lafal dan intonasi yang tepat 2. Menyampaikan pesan yang diterima melalui telepon sesuai dengan isi pesan 1. Menemukan kalimat utama pada tiap paragraf melalui membaca intensif 2. Membaca nyaring suatu pengumuman dengan lafal dan intonasi yang tepat 3. Membaca pantun anak secara berbalasan dengan lafal dan intonasi yang tepat 1. Menyusun karangan tentang berbagai topik sederhana dengan memperhatikan penggunaan ejaan (huruf besar, tanda tiik, tanda koma, dll.) 2. Menulis pengumuman dengan bahasa yang baik dan benar Indonesia National Assessment Programme (INAP) 27

28 serta memperhatikan penggunaan ejaan 3. Membuat pantun anak yang menarik tentang berbagai tema (persahabatan, ketekunan, kepatuhan, dll.) sesuai dengan ciri-ciri pantun 5. Kelas 5 (Lima) Semester I Standard Kompetensi Mendengarkan Memahami penjelasan narasumber dan cerita rakyat secara lisan Berbicara Mengungkapkan pikiran, pendapat, perasaan, fakta secara lisan dengan menanggapi suatu persoalan, menceritakan hasil pengamatan, atau berwawancara Kompetensi Dasar 1. Menanggapi penjelasan narasumber (petani, pedagang, nelayan, karyawan, dll.) dengan memperhatikan santun berbahasa 2. Mengidentifikas i unsur cerita tentang cerita rakyat yang didengarnya 1. Menanggapi suatu persoalan atau peristiwa dan memberikan saran pemecahannya dengan memperhatikan pilihan kata dan santun berbahasa 2. Menceritakan hasil pengamatan/kunjungan dengan bahasa runtut, baik, dan benar 3. Berwawancara sederhana dengan narasumber (petani, pedagang, nelayan, karyawan, Indonesia National Assessment Programme (INAP) 28

29 dll.) dengan memperhatkian pilihan kata dan santun berbahasa Membaca Memahami teks dengan membaca teks percakapan, membaca cepat 75 kata/menit, dan membaca puisi Menulis Mengungkapkan pikiran, perasaan, informasi, dan pengalaman secara tertulis dalam bentuk karangan, surat undangan, dan dialog tertulis 1. Membaca teks percakapan dengan lafal dan intonasi yang tepat 2. Menemukan gagasan utama suatu teks yang dibaca dengan kecepatan 75 kata per menit 3. Membaca puisi dengan lafal dan intonasi yang tepat 1. Menulis karangan berdasarkan pengalaman dengan memperhatikan pilihan kata dan penggunaan ejaan 2. Menulis surat undangan (ulang tahun, acara agama, kegiatan sekolah, kenaikan kelas, dll.) dengan kalimat efektif dan memperhatikan penggunaan ejaan 3. Menulis dialog sederhana antara dua atau tiga tokoh dengan memperhatikan isi serta perannya Semester II Standard Kompetensi Mendengarkan Memahami cerita tentang suatu Kompetensi Dasar 1. Menanggapi cerita tentang peristiwa yang terjadi di sekitar Indonesia National Assessment Programme (INAP) 29

30 peristiwa dan cerita pendek anak yang disampaikan secara lisan Berbicara Mengungkapkan pikiran dan perasaan secara lisan dalam diskusi dan bermain drama Membaca Memahami teks dengan membaca sekilas, membaca memindai, dan membaca cerita anak Menulis Mengungkapkan pikiran, perasaan, informasi, dan fakta secara tertulis dalam bentuk ringkasan, laporan, dan puisi bebas yang disampaikan secara lisan 2. Mengidentifikasi unsur cerita (tokoh, tema, latar, amanat) 1. Mengomentari persoalan faktual disertai alasan yang mendukung dengan memperhatikan pilihan kata dan santun berbahasa 2. Memerankan tokoh drama dengan lafal, intonasi, dan ekspresi yang tepat 1. Membandingkan isi dua teks yang dibaca dengan membaca sekilas 2. Menemukan informasi secara cepat dari berbagai teks khusus (buku petunjuk telepon, jadwal perjalanan, daftar susunan acara, daftar menu, dll.) yang dilakukan melalui membaca memindai 3. Menyimpulkan isi cerita anak dalam beberapa kalimat 1. Meringkas isi buku yang dipilih sendiri dengan memperhatikan penggunaan ejaan 2. Menulis laporan pengamatan atau kunjungan berdasarkan tahapan (catatan, konsep awal, perbaikan, final) dengan Indonesia National Assessment Programme (INAP) 30

31 memperhatikan penggunaan ejaan 3. Menulis puisi bebas dengan pilihan kata yang tepat 6. Kelas 6 (Enam) Semester I Standard Kompetensi Mendengarkan Memahami teks dan cerita anak yang dibacakan Berbicara Memberikan informasi dan tanggapan secara lisan Membaca Memahami teks dengan membaca intensif dan membaca sekilas Menulis Mengungkapkan pikiran, perasaan, dan Kompetensi Dasar 1. Menulis hal-hal penting/pokok dari suatu teks yang dibacakan 2. Mengidentfikasi tokoh, watak, latar, tema atau amanat dari cerita anak yang dibacakan 1. Menyampaikan pesan/informasi yang diperoleh dari berbagai media dengan bahasa yang runtut, baik dan benar 2. Menanggapi (mengkritik/memuji) sesuatu hal disertai alasan dengan menggunakan bahasa yang santun 1. Mendeskripsikan isi dan teknik penyajian suatu laporan hasil pengamatan/kunjungan 2. Menanggapi informasi dari kolom/rubrik khusus (majalah anak, koran, dll.) 1. Mengisi formulir (pendaftaran, kartu anggota, wesel pos, kartu Indonesia National Assessment Programme (INAP) 31

32 informasi secara tertulis dalam bentuk formulir, ringkasan, dialog, dan parafrase pos, daftar riwayat hidup, dll.) dengan benar 2. Membuat ringkasan dari teks yang dibaca atau yang didengar 3. Menyusun percakapan tentang berbagai topik dengan memperhatikan penggunaan ejaan 4. Mengubah puisi ke dalam bentuk prosa dengan tetap memperhatikan makna puisi Semester II Standard Kompetensi Mendengarkan Memahami wacana lisan tentang berita dan drama pendek Berbicara Mengungkapkan pikiran, perasaan, dan informasi dengan berpidato, melaporkan isi buku, dan baca puisi Kompetensi Dasar 1. Menyimpulkan isi berita yang didengar dari televisi atau radio 2. Menceritakan isi drama pendek yang disampaikan secara lisan 1. Berpidato atau presentasi untuk berbagai keperluan (acara perpisahan, perayaan ulang tahun, dll.) dengan lafal, intonasi, dan sikap yang tepat 2. Melaporkan isi buku yang dibaca (judul, pengarang, jumlah halaman, dan isi) dengan kalimat yang runtut 3. Membacakan puisi karya sendiri dengan ekspresi yang tepat Indonesia National Assessment Programme (INAP) 32

33 Membaca Memahami teks dengan membaca intensif dan membaca teks drama Menulis Mengungkapkan pikiran dan informasi secara tertulis dalam bentuk naskah pidato dan surat resmi 1. Menemukan makna tersirat suatu teks melalui membaca intensif 2. Mengidentifikasi berbagai unsur (tokoh, sifat, latar, tema, jalan cerita, dan amanat) dari teks drama anak 1. Menyusun naskah pidato/sambutan (perpisahan, ulang tahun, perayaan sekolah, dll.) dengan bahasa yang baik dan benar, serta memperhatikan penggunaan ejaan 2. Menulis surat resmi dengan memperhatikan pilihan kata sesuai dengan orang yang dituju C. Pembelajaran IPA SD/MI Pembelajaran IPAdi sekolah dasar merupakanpenguasaan siswa terhadap pengetahuan tentang alam sekitar,yang dipelajari darifakta-fakta, prinsipprinsip,dan proses penemuan. Pengetahuan siswa tentang alam tersebut dapat mencetak siswa dalam bersikap ilmiah. Namun materiipayang diberikan harus disesuaikan dengan usia dan karakteristik siswa yang bersangkutan. Dalam Kurikulum Tingkat Satuan Pendidikan (KTSP) 2006 untuks D/MI dijelaskan bahwa pembelajaran Ilmu Pengetahuan Alam(IPA )berhubungan dengan cara mencari tahu tentang alam secara sistematis, sehingga IPA bukan hanya penguasaan kumpulan pengetahuan yang berupa fakta-fakta, konsepkonsep, atau prinsip-prinsip saja tetapi juga merupakan suatu proses penemuan. Pendidikan IPA diharapkan dapat menjadi Indonesia National Assessment Programme (INAP) 33

34 Wahana bagi peserta didik untuk mempelajari diri sendiri dan alam sekitar,serta prospek pengembangan lebih lanjut dalam menerapkannya didalam kehidupan sehari-hari.proses pembelajarannya menekankanp ada pemberian pengalaman langsung untuk mengembangkan kompetensi agar menjelajahi dan memahami alamsekitar secara ilmiah. Pendidikan IPA diarahkan untuk inkuiri dan berbuat sehingga dapat membantu peserta didik untuk memperoleh pemahaman yang lebih mendalam tentang alam sekitar. BNSP(2007:13).Dari penjelasan tersebut pendidikan IPA menekankan pada pemberian pengalaman belajar secara langsung. Dalam pembelajaran IPA siswa difasilitasi untuk mengembangkan sejumlah keterampilan proses. IPA diperlukan dalam kehidupan sehari-hari untuk memenuhi kebutuhan manusia melalui pemecahan masalah-masalah yang dapat diidentifikasikan.penerapan IPA perlu dilakukan secara bijaksana agar tidak berdampak buruk terhadap lingkungan. Di tingkat SD/MI diharapkan ada penekanan pembelajaran Saling temas (Sains,lingkungan,teknologi, dan masyarakat) yang diarahkan pada pengalaman belajar untuk merancang dan membuat suatu karya melalui penerapan konsep IPA dan kompetensi bekerja ilmiah secara bijaksana. Selanjutnya menurut BNSP(2007:13) matapelajaran IPA di SD/MI bertujuan agar peserta didik memiliki kemampuan sebagai berikut: 1. Memperoleh keyakinan terhadap kebesaran Tuhan Yang Maha Esa berdasarkan keberadaan,keindahan dan keteraturan alam ciptaan-nya; 2. Mengembangkan pengetahuan dan pemahaman konsep-konsep IPA yang bermanfaat dan dapat diterapkan dalam kehidupan sehari-hari; 3. Mengembangkan rasa ingintahu, sikap positif dan kesadaran tentang adanya hubungan yangs aling mempengaruhi antaraipa, lingkungan, teknologi dan masyarakat; 4. Mengembangkan keterampilan proses untuk menyelidiki alam sekitar, memecahkan masalah dan membuat keputusan; 5. Meningkatkan kesadaran untuk berperan serta dalam memelihara, menjaga dan melestarikan lingkunganalam; Indonesia National Assessment Programme (INAP) 34

35 6. Meningkatkan kesadaran untuk menghargai alam dan segala keteraturannya sebagai salah satu ciptaan Tuhan; 7. Memperoleh bekal pengetahuan,konsep dan keterampilan IPA sebagai dasar untuk melanjutkan pendidikan kesmp/mts. Berikut standar kompetensi dan kompetensi dasar pada jenjang SD/MI yang menjadi arah dan landasan untuk mengembangkan materi pokok, kegiatan pembelajaran, dan indikator pencapaian kompetensi untuk penilaian. Kelas 1, Semester 1 StandarKompetensi Makhluk Hidup dan Proses Kehidupan 1. Mengenal anggota tubuhdan kegunaannya,sert a cara perawatannya 2. Mengenal cara memelihara lingkungan agar tetap sehat Benda dan Sifatnya 3. Mengenal berbagai sifat benda dan kegunaannya melalui pengamatan perubahan bentuk benda KompetensiDasar 1.1Mengenal bagian-bagian tubuh dan kegunaannya serta cara perawatannya 1.2 Mengidentifikasi kebutuhan tubuh agar tumbuh sehat dan kuat(makanan,air,pakaian,udara, lingkungan sehat) 1.3 Membiasakan hidup sehat 2.1 Mengenal cara menjaga lingkungan agar tetap sehat 2.2 Membedakan lingkungan sehat dengan lingkungan tidak sehat 2.2 Menceritakan perlunya merawat tanaman,hewan peliharaan dan lingkungan sekitar 3.1 Mengidentifikasi benda yang ada di lingkungan sekitar berdasarkan cirinya melalui pengamatan 3.2 Mengenal benda yang dapat diubah bentuknya 3.3 Mengidentifikasi kegunaan bendadilingkungan sekitar Indonesia National Assessment Programme (INAP) 35

36 Kelas 1, Semester 2 StandarKompetensi Energi dan Perubahannya 4. Mengenal berbagai bentuk energy dan manfaatnya dalam kehidupan seharihari Bumidan Alam Semesta 5. Mengenal berbagai benda langit dan peristiwa alam (cuaca danmusim) serta pengaruhnya terhadap kegiatan manusia. KompetensiDasar 4.1 Membedakan gerak benda yang mudah bergerak dengan yang sulit bergerak melalui percobaan 4.2 Mengidentifikasi penyebab benda bergerak (batere,per/pegas, dorongan tangan,dan magnet) 5.1 Mengenal berbagai benda langitmelalui pengamatan 5.2 Mengenal keadaan cuaca disekitar kita 5.3 Membedakan pengaruh musim kemarau dengan musim hujan terhadap kegiatan manusia Indonesia National Assessment Programme (INAP) 36

37 Kelas 2, Semester 1 StandarKompetensi Makhluk Hidup dan Proses Kehidupan 1. Mengenal bagianbagian utama tubuh hewan dan tumbuhan, pertumbuhan hewan dantumbuhan serta berbagai tempat hidup makhluk hidup KompetensiDasar 1.1Mengenal bagian-bagian utama hewan dan tumbuhan disekitar rumah dan sekolah melalui pengamatan 1.2Mengidentifikasi perubahan yang terjadi pada pertumbuhan hewan (dalamukuran) dan tumbuhan (dari bij imenjadi tanaman) 1.3Mengidentifikasi berbagai tempat hidup makhluk hidup(air,tanah dan tempat lainnya) 1.4Mengidentifikasi makhluk hidup yang menguntungkan dan membahayakan Benda dan Sifatnya 2. Mengenal berbagai bentuk benda dan kegunaannya serta perubahan wujud yang dapat dialaminya 2.1Mengidentifikasi ciri ciri benda padat dan cair yang ada dilingkungan sekitar 2.2Menunjukkan perubahan bentuk dan wujud benda (plastisin/tanahliat/adonantepung) akibat dari kondisi tertentu 2.3Mengidentifikasi benda-benda yang dikenaldan kegunaannya melalui pengamatan Kelas 2, Semester 2 StandarKompetensi Energi dan Perubahannya 3. Mengenal berbagai sumber energy yang sering dijumpai dalam kehidupan sehari-hari dan kegunaannya KompetensiDasar 3.1 Mengidentifikasi sumber-sumber energi(panas, listrik,cahaya,dan bunyi) yang ada di lingkungan sekitar 3.2 Mengidentifikasi jenis energy yang paling sering digunakan dilingkungans ekitar dan cara menghematnya Indonesia National Assessment Programme (INAP) 37

38 Bumi dan AlamSemesta 4. Memahami peristiwa alam dan pengaruh matahari dalam kehidupan seharihari 4.1 Mengidentifikasikenampakanmataharipadapagi, siangdansorehari 4.2 Mendeskripsikankegunaanpanasdancahaya mataharidalamkehidupansehari-hari Kelas 3, Semester 1 Standar Kompetensi Makhluk Hidup dan Proses Kehidupan 1. Memahami ciri-ciri dan kebutuhan makhluk hidup serta hal-hal yang mempengaruhi perubahan pada makhluk hidup KompetensiDasar 1.1 Mengidentifikasiciri-ciridankebutuhanmakhluk hidup 1.2 Menggolongkanmakhlukhidupsecarasederhana 1.3 Mendeskripsikan perubahanyangterjadipada makhlukhidupdanhal-halyangmempengaruhi pertumbuhandanperkembangananak(makanan, kesehatan,rekreasi,istirahatdanolahraga) 2. Memahami kondisi lingkungan yang berpengaruh terhadap kesehatan,dan upaya menjaga kesehatan lingkungan Benda dan Sifatnya 3. Memahami sifatsifat, perubahan sifat benda dan kegunaannya dalam kehidupan seharihari 2.1 Membedakanciri-cirilingkungan sehatdan lingkungantidaksehatberdasarkanpengamata n 2.2 Mendeskripsikankondisilingkunganyang berpengaruhterhadapkesehatan 2.3 Menjelaskancaramenjagakesehatanlingkungan sekitar 3.1 Mengidentifikasisifat-sifatbendaberdasarkan pengamatanmeliputibendapadat,cair,dangas 3.2 Mendeskripsikanperubahansifatbenda(ukuran, bentuk,warna,ataurasa)yangdapatdiamati akibatdaripembakaran,pemanasan,dan diletakkandiudaraterbuka 3.3 Menjelaskankegunaanbendaplastik,kayu,kaca, dankertas Indonesia National Assessment Programme (INAP) 38

39 Kelas 3, Semester 2 Standar Kompetensi Energi dan Perubahannya.Memahami berbagai cara gerak benda, hubungannyadengan energy dan sumber energy KompetensiDasar 4.1 Menyimpulkanhasilpengamatanbahwagerak bendadipengaruhiolehbentukdanukuran 4.2 Mendeskripsikanhasilpengamatantentang pengaruhenergipanas,gerak,getarandalam kehidupansehari-hari 4.3 Mengidentifikasisumberenergidankegunaannya 5. Menerapkank onsep energy gerak Bumi dan Alam Semesta 6. Memahami kenampakan permukaanbumi,cuaca dan pengaruhnya bagi manusia,serta hubungannya dengan cara manusia memelihara dan melestarikan alam 5.1 Membuat kinciranginuntukmenunjukkan bentuk energiangindapatdiubahmenjadi energigerak 5.2 Menerapkancaramenghematenergidalam kehidupansehari-hari 6.1 Mendeskripsikankenampakanpermukaa n bumidilingkungansekitar 6.2 Menjelaskanhubunganantarakeadaanawandan cuaca 6.3 Mendeskripsikanpengaruhcuacabagikegiatan manusia 6.4 Mengidentifikasicaramanusiadalammemelihara danmelestarikanalamdilingkungansekitar Kelas 4, Semester 1 Standar Kompetensi Makhluk Hidup dan Proses Kehidupan 1.Memahami hubungan antara struktur organ tubuh manusia dengan fungsinya,serta pemeliharaannya 1.1 KompetensiDasar Mendeskripsikanhubunganantarastrukturkerang ka tubuhmanusiadenganfungsinya 1.2 Menerapkancaramemeliharakesehatankerangka tubuh 1.3 Mendeskripsikanhubunganantarastrukturpanca inderadenganfungsinya 1.4 Menerapkancaramemeliharakesehatanpanca indera Indonesia National Assessment Programme (INAP) 39

40 2.Memahami hubungan antara struktur bagian tumbuhan dengan fungsinya 3.Menggolongkan hewan,berdasarka n jenis makanannya 4. Memahami daur hidup beragam jenis Makhluk hidup 5.Memahami hubungan sesame makhluk hidup dan antara makhluk hidup dengan lingkungannya Benda dan Sifatnya 6.Memahami beragam sifat dan perubahan wujud benda serta berbagai cara penggunaan benda berdasarkan sifatnya 2.1 Menjelaskan hubunganantarastrukturakar tumbuhandenganfungsinya 2.2 Menjelaskanhubunganantarastrukturbatang tumbuhandenganfungsinya 2.3 Menjelaskanhubunganantarastrukturdaun tumbuhandenganfungsinya 2.4 Menjelaskan hubunganantarabungadengan fungsinya 3.1 Mengidentifikasijenismakananhewan 3.2 Menggolongkanhewanberdasarkanjenis makanannya 4.1 Mendeskripsikandaurhidupbeberapahewandi lingkungansekitar,misalnyakecoa,nyamuk,kupukupu,kucing 4.2 Menunjukkankepedulian terhadaphewan peliharaan,misalnyakucing,ayam,ikan 5.1 Mengidentifikasibeberapajenishubungankhas (simbiosis) dan hubungan makandandimakan antarmakhlukhidup(rantaimakanan) 5.2 Mendeskripsikanhubunganantaramakhlukhidup denganlingkungannya 6.1 Mengidentifikasiwujudbendapadat,cair,dangas memilikisifattertentu 6.2 Mendeskripsikanterjadinyaperubahanwujudcair padat cair;cair gas cair; padat gas 6.3 Menjelaskanhubunganantarasifatbahandengan kegunaannya Indonesia National Assessment Programme (INAP) 40

41 Kelas 4, Semester 2 StandarKompetensi Energi dan Perubahannya 7. Memahami gaya dapat mengubah gerak dan/atau bentuk suatu benda 8.Memahami berbagai bentuk energy dancara penggunaannya dalam kehidupan sehari-hari KompetensiDasar 7.1 Menyimpulkanhasilpercobaanbahwagaya (dorongandantarikan)dapatmengubahgerak suatubenda 7.2 Menyimpulkanhasilpercobaanbahwagaya (dorongandantarikan)dapatmengubahbentuk suatubenda 8.1 Mendeskripsikanenergipanasdanbunyiyang terdapatdilingkungansekitarserta sifat-sifatnya 8.2 Menjelaskanberbagaienergialternatifdancara penggunaannya 8.3 Membuatsuatukarya/modeluntukmenunjukkan perubahanenergigerakakibatpengaruhudara, misalnyaroketdarikertas/balingbaling/pesawat kertas/parasut 8.4 Menjelaskanperubahanenergibunyimelalui penggunaanalatmusik Bumi dan Alam Semesta 9. Memahami perubahan kenampakan permukaan bumi dan benda langit 9.1 Mendeskripsikanperubahankenampakanbumi 9.2 Mendeskripsikanposisibulandankenampakan bumidariharikehari 10.Memahami perubahan lingkungan fisik dan pengaruhnya terhadap daratan 10.1Mendeskripsikanberbagaipenyebabperubaha n lingkunganfisik (angin,hujan,cahayamatahari, dangelombangairlaut) 10.2Menjelaskanpengaruhperubahanlingkunganfisik terhadapdaratan(erosi,abrasi,banjir,danlongsor) 10.3Mendeskripsikancarapencegahankerusaka n lingkungan(erosi,abrasi,banjir,danlongsor) Indonesia National Assessment Programme (INAP) 41

42 11.Memahami hubungan antara sumber daya alam dengan lingkungan,teknologi, dan masyarakat 11.1Menjelaskanhubunganantarasumberdayaalam denganlingkungan 11.2Menjelaskanhubunganantarasumberdayaalam denganteknologiyangdigunakan 11.3Menjelaskandampakpengambilanbahanalam terhadappelestarianlingkungan Kelas 5, Semester 1 Standar Kompetensi Makhluk Hidup dan Proses Kehidupan 1.Mengidentifikasi fungsi organ tubuh manusia dan hewan KompetensiDasar 1.1Mengidentifikasifungsiorganpernapasanmanusia 1.2Mengidentifikasifungsiorganpernapasanhewan misalnyaikandancacingtanah 1.3Mengidentifikasifungsiorganpencernaanmanusia danhubungannyadenganmakanandankesehatan 1.4Mengidentifikasiorganperedarandarahmanusia 1.5Mengidentifikasigangguanpadaorganperedaran darahmanusia 2.Memahami cara tumbuhan hijau membuat makanan 3.Mengidentifikasi cara makhluk hidup menyesuaikan diri dengan lingkungan Benda dan Sifatnya 4. Memahami hubungan antara sifat bahan dengan penyusunnya dan perubahan sifat benda sebagai hasil suatu proses 2.1Mengidentifikasicaratumbuhanhijau membuat makanan 2.2Mendeskripsikanketergantunganmanusiadanhewan padatumbuhanhijausebagaisumbermakanan 3.1Mengidentifikasipenyesuaiandirihewandengan lingkungantertentu untukmempertahankanhidup 3.2Mengidentifikasipenyesuaiandiritumbuhandengan lingkungantertentu untukmempertahankanhidup 4.1 Mendeskripsikanhubungan antarasifatbahan denganbahanpenyusunnya,misalnyabenang,kain, dankertas 4.2Menyimpulkan hasilpenyelidikantentangperubahan sifatbenda,baiksementaramaupuntetap Indonesia National Assessment Programme (INAP) 42

43 Kelas 5, Semester 2 Standar Kompetensi Energi dan Perubahannya 5. Memahami hubungan antara gaya,gerak, dan energi,serta fungsinya 6. Menerapkan sifatsifat cahaya melalui kegiatan membuat suatu karya/model KompetensiDasar 5.1Mendeskripsikanhubunganantaragaya,gerakdan energimelaluipercobaan(gayagravitasi,gayagesek, gayamagnet) 5.2Menjelaskanpesawatsederhanayangdapatmembuat pekerjaanlebihmudahdanlebihcepat 6.1Mendeskripsikansifat-sifatcahaya 6.2 Membuatsuatukarya/model,misalnyaperiskopatau lensadari bahansederhanadenganmenerapkansifatsifatcahaya Bumi dan Alam Semesta 7. Memahami perubahanyang terjadidi alam dan hubungannya dengan penggunaan sumber daya alam 7.1Mendeskripsikanprosespembentukantanahkarena pelapukan 7.2Mengidentifikasijenis-jenistanah 7.3Mendeskripsikanstrukturbumi 7.4Mendeskripsikanprosesdaurairdankegiatan manusiayangdapatmempengaruhinya 7.5Mendeskripsikan perlunya penghematanair 7.6Mengidentifikasiperistiwa alamyangterjadidi Indonesiadandampaknyabagimakhlukhidupdan lingkungan 7.7Mengidentifikasi beberapakegiatanmanusiayang dapatmengubahpermukaanbumi(pertanian, perkotaan,dsb) Indonesia National Assessment Programme (INAP) 43

44 Kelas 6, Semester 1 StandarKompetensi Makhluk Hidup dan Proses Kehidupan 1.Memahami hubungan antara ciri-ciri Makhluk hidup dengan Lingkungan tempat hidupnya 2.Memahami cara perkembang biakan makhluk hidup KompetensiDasar 1.1 Mendeskripsikanhubungan antaraciricirikhusus yang dimilikihewan(kelelawar,cicak,bebek) dan lingkunganhidupnya 1.2Mendeskripsikan hubungan antaraciri-cirikhusus yangdimilikitumbuhan (kaktus,tumbuhan pemakanserangga)denganlingkunganhidupnya 2.1Mendeskripsikan perkembangandanpertumbuhan manusiadaribayisampailanjutusia 2.2Mendeskripsikan ciri-ciri perkembanganfisikanak laki-lakidanperempuan 2.3Mengidentifikasicaraperkembangbiakantumbuha n danhewan 2.4Mengidentifikasicaraperkembangbiakanmanusia 3.Memahami pengaruh kegiatan manusia terhadap keseimbangan lingkungan 3.1Mengidentifikasikegiatanmanusiayangdapat mempengaruhikeseimbanganalam(ekosistem ) 3.2Mengidentifikasibagiantumbuhanyangsering dimanfaatkanmanusiayangmengarahpada ketidakseimbanganlingkungan 3.3Mengidentifikasibagiantubuhhewanyangsering dimanfaatkanmanusiayangmengarahpada ketidakseimbanganlingkungan 4.Memahami pentingnya pelestarian jenis makhluk hidup untuk mencegah kepunahan 4.1Mengidentifikasijenishewandantumbuhanyang mendekati kepunahan 4.2Mendeskripsikan pentingnyapelestarianjenis makhluk hidupuntukperkembanganilmu PengetahuanAlamdankehidupanmasyarakat Indonesia National Assessment Programme (INAP) 44

45 Benda dan Sifatnya 5.Memahami saling hubungan antara suhu, sifat hantaran dan kegunaan benda 6.Memahami faktor penyebab perubahan benda a. Membandingkansifatkemampuanmenghantark an panasdariberbagaibenda b. Menjelaskanalasanpemilihanbendadalam kehidupansehari-hariberdasarkankemampuan menghantarkanpanas 6.1Menjelaskan faktor-faktorpenyebabperubahan benda(pelapukan,perkaratan,pembusukan)melalu i pengamatan 6.2Mengidentifikasifaktor-faktoryangmenentukan pemilihanbenda/bahanuntuktujuantertentu(karet, logam,kayu,plastik)dalamkehidupansehari-hari Kelas 6, Semester 2 Standar Kompetensi Energi dan Perubahannya 7.Mempraktikkan pola penggunaan dan perpindahan energi KompetensiDasar 7.1Melakukanpercobaanuntukmenyelidikihubungan antaragayadangerak(modeljungkatjungkit, katapel/modeltraktorsederhanaenergipegas) 7.2Menyajikaninformasitentangperpindahandan perubahanenergilistrik 8.Memahami pentingnya penghematan energi 8.1 Mengidentifikasikegunaanenergilistrikdan berpartisipasidalam penghematannyadalam kehidupanseharihari 8.2Membuat suatu karya/model yangmenggunakan energy listrik(bel listrik/alarm/model lampu lalu lintas/kapalterbang/mobil-mobilan/model Indonesia National Assessment Programme (INAP) 45

46 Bumi dan Alam Semesta 9.Memahami matahari sebagai pusat tata suryadan interaksi bumi dalam tatasurya 9.1Mendeskripsikan system tatasurya dan posisi penyusun tatasurya 9.2Mendeskripsikan peristiwa rotasi bumi,revolusi bumi dan revolusi bulan 9.3Menjelaskan terjadinya gerhana bulan dan gerhana matahari 9.4Menjelaskan perhitungan kalender Masehi dan kalender Hijriah D. Pengukuran, Penilaian, dan Evaluasi Hasil Belajar Pengukuran merupakan suatu kegiatan yang dilakukan untuk mengukur dalam arti memberi angka terhadap sesuatu yang disebut objek pengukuran (Djaali & Pudji Muljono, 2008:2). Pengukuran adalah proses pemberian angka atau usaha memperoleh deskripsi numerik dari suatu tingkatan di mana seorang siswa telah mencapai karakteristik tertentu. Pengukuran bersifat kuantitatif. Berdasarkan berbagai pendapat tersebut, pengukuran dapat diartikan sebagai kegiatan yang dilakukan untuk mengukur sesuatu, sedangkan mengukur adalah membandingkan sesuatu dengan atau atas dasar ukuran tertentu. Pengukuran hasil belajar dilakukan dengan menggunakan tes. Berdasarkan standarisasinya, tes yang digunakan untuk mengukur hasil belajar ada dua yaitu tes baku dan tes buatan guru (Djaali & Pudji Muljono, 2008:4). Adapun terkait penilaian, menurut Suharsimi Arikunto (2010:3), menilai adalah mengambil suatu keputusan terhadap sesuatu dengan ukuran baik buruk. Penilaian merupakan suatu tindakan atau proses menentukan nilai sesuatu objek (Djaali & Pudji Muljono, 2008:2). Penilaian bersifat kualitatif. Berdasarkan Peraturan Pemerintah Republik Indonesia Nomor 19 Tahun 2005 tentang Standar Nasional Pendidikan bab 1 pasal 1, penilaian adalah proses pengumpulan dan pengolahan informasi untuk mengukur pencapaian hasil belajar peserta didik. Sedangkan penilaian hasil belajar adalah proses pemberian nilai terhadap hasil-hasil belajar yang dicapai siswa dengan kriteria tertentu (Nana Sudjana, 1989:3). Berdasarkan pengertian tersebut, penilaian berarti Indonesia National Assessment Programme (INAP) 46

47 menilai sesuatu. Menilai mengandung arti mengambil keputusan terhadap sesuatu dengan ukuran baik atau buruk, sehat atau sakit dan sebagainya. Penilaian dilaksanakan secara sistematis dan berkesinambungan untuk memperoleh, menganalisis, dan menafsirkan proses dan hasil belajar siswa. Selain itu, untuk pengambilan keputusan dalam menentukan keberhasilan mencapai kompetensi yang telah ditentukan. Penilaian hasil belajar oleh satuan pendidikan bertujuan menilai pencapaian standar kompetensi lulusan untuk semua mata pelajaran yang dilakukan dalam bentuk ujian sekolah/ madrasah. Sedangkan penilaian hasil belajar oleh pemerintah bertujuan untuk menilai pencapaian kompetensi lulusan secara nasional pada mata pelajaran tertentu yang dilakukan dalam bentuk ujian nasional. Tentang pengertian evaluasi, menurut Norman E. Gronlund & Robert L. Linn (1990: 5), evaluasi merupakan suatu proses sistematis dalam mengumpulkan, menganalisis, dan menginterpretasikan informasi untuk menentukan besarnya tujuan pembelajaran yang dicapai siswa. Evaluasi dapat juga diartikan sebagai proses menilai sesuatu berdasarkan kriteria atau tujuan yang telah ditetapkan, yang selanjutnya diikuti dengan pengambilan keputusan atas objek yang dievaluasi. Evaluasi hasil belajar digunakan untuk menunjukkan sampai di mana tingkat kemampuan dan keberhasilan siswa dalam pencapaian tujuan- tujuan kurikuler. Berdasarkan pengertian pengukuran, penilaian, dan evaluasi di atas, maka jelas bahwa pengukuran, penilaian dan evaluasi saling berkaitan, namun berbeda dan pelaksanaannya. Pengukuran adalah langkah awal dari kegiatan evaluasi. Penilaian tidak dapat terjadi tanpa pengukuran. Untuk dapat menentukan nilai dari sesuatu yang sedang dinilai, dilakukan pengukuran. Kegiatan mengukur dan menilai itulah yang disebut dengan evaluasi. Dalam sistem pendidikan nasional, rumusan tujuan pendidikan, baik tujuan kurikuler maupun tujuan instruksional, menggunakan klasifikasi hasil belajar dari Benyamin Bloom yang secara garis besar membaginya menjadi tiga ranah, yakni ranah kognitif, ranah afektif dan ranah psikomotorik. (Nana Sudjana,1989:22). Ketiga ranah tersebut menjadi objek penilaian hasil belajar. Indonesia National Assessment Programme (INAP) 47

48 Diantara ketiga ranah tersebut, ranah kognitiflah yang paling banyak dinilai oleh para guru di sekolah karena berkaitan dengan kemampuan para siswa dalam menguasai materi pelajaran. Menurut Anas Sudijono (1998:50), Bloom membagi tingkat kemampuan atau tipe hasil belajar yang termasuk aspek kognitif menjadi enam, yaitu pengetahuan (knowledge), pemahaman (comprehension), aplikasi (application), analisis (analysis), sintesis (syntesis), dan evaluasi (evaluation), namun telah direvisi oleh Lorin W. Anderson dan David R.Krathwohl (2001) menjadi mengingat (remember), memahami (understand), menerapkan (apply), menganalisis (analyze), menilai (evaluate), menciptakan (create). Perbaikan Lorin W. Anderson and David R.Krathwohl memadukan jenis pengetahuan yang akan dipelajari dan proses yang digunakan untuk belajar (proses kognitif). Pengetahuan terbagi dalam pengetahuan faktual (factual knowledge), pengetahuan konseptual (conceptual knowledge), pengetahuan prosedural (procedural knowledge), dan pengetahuan meta kognitif (meta-cognitive knowledge). Tabel 1. Aspek Kognitif dalam Taksonomi Bloom yang Direvisi Oleh Lorin W. Anderson dan David R. Krathwohl (2001) Aspek kognitif 1. Mengingat (remember) 1.1 Mengenali (recognizing) 1.2 Memunculkan kembali (recalling) 2. Memahami (understand) Keterangan Memunculkan kembali pengetahuan relevan dari kenangan jangka panjang (long-term memory). Menemukan pengetahuan di kenangan jangka panjang (long-term memory) yang konsisiten dengan bahan yang diberi. Contohnya pada soal benar-salah dan soal pilihan ganda. Memunculkan kembali pengetahuan relevan dari kenangan jangka panjang (long-term memory). Membangun konsep dari pesan instruksional, termasuk lisan, tertulis, komunikasi grafik. Indonesia National Assessment Programme (INAP) 48

49 Aspek kognitif 2.1 Menterjemahkan (interpreting) 2.2 Mencontohkan (exemplifying) 2.3 Menggolongkan (classifying) 2.4 Meringkas (summarizing) 2.5 Menunjukkan (inferring) 2.6 Membandingkan (comparing) 2.7 Menerangkan (explaining) Keterangan Menguraikan dengan kata-kata sendiri dari satu bentuk gambaran atau representasi. Menemukan contoh khusus atau gambaran dari konsep atau prinsip Mengetahui bahwa sesuatu mempunyai kategori. Mengintisarikan tema umum atau poin utama. Menarik kesimpulan logis dari informasi yang diberi. Mengetahui korespondensi antara dua gagasan, objek dan sejenisnya. Membangun hubungan sebab-akibat dari sebuah sistem. 3. Menerapkan (apply) Menggunakan prosedur di dalam situasi tertentu. 4. Menganalisis (analyze) Membagi materi ke dalam bagian-bagian unsur pokoknya dan menentukan bagaimana bagianbagian tersebut berhubungan satu sama lain seperti sampai kepada maksud keseluruhan. 4.1 Membedakan (differentiating) 4.2 Menyelenggarakan (organizing) Membedakan bahan yang diberikan, bagianbagian yang relevan dari yang tidak relevan, bagian-bagian yang penting dari yang tidak penting. Menentukan bagaimana elemen sesuai atau berfungsi dalam struktur. 4.3 Mengaitkan (attributing) Menentukan sudut pandang, prasangka, nilai atau maksud yang mendasari materi yang diberikan. 5. Menilai (evaluate) Membuat keputusan berdasarkan kriteria atau ukuran tertentu. 5.1 Memeriksa (checking) 5.2 Mengomentari (critiquing) Mengetahui ketidakkonsistenan atau kekeliruan dalam proses atau produk yang mempunyai konsistensi mendalam, mengetahui keefektifan prosedur saat dilaksanakan. Mengetahui ketidakkonsistenan antara produk dan kriteria eksternal, memutuskan apakah produk mempunyai ketetapan eksternal, Indonesia National Assessment Programme (INAP) 49

50 Aspek kognitif Keterangan mengetahui kepatutan prosedur untuk masalah yang diberikan. 6. Menciptakan (create) Penyatuan bagian-bagian ke dalam suatu bentuk yang menyeluruh. 6.1 Menghasilkan (generating) 6.2 Merencanakan (planning) 6.3 Menghasilkan (producing) Menghasilkan hipotesis alternatif yang berdasarkan kriteria. Memikirkan prosedur untuk menyelesaikan beberapa tugas. Menciptakan produk. E. Tes Tes pada umumnya digunakan untuk menilai dan mengukur hasil belajar siswa, terutama hasil belajar kognitif berkenaan dengan penguasaan bahan pengajaran sesuai dengan tujuan pendidikan dan pengajaran. Menurut Nana Sudjana (1989:35), tes sebagai alat penilaian adalah pertanyaan-pertanyaan yang diberikan kepada siswa untuk mendapat jawaban dari siswa dalam bentuk lisan (tes lisan), dalam bentuk tulisan (tes tulisan), atau dalam bentuk perbuatan (tes tindakan). Sedangkan menurut Ngalim Purwanto (1984:33), yang dimaksud tes hasil belajar (achievement tes) ialah tes yang dipergunakan untuk menilai hasilhasil pelajaran yang telah diberikan oleh guru kepada siswa-siswanya, dalam jangka waktu tertentu. Pendapat lain menyatakan bahwa tes hasil belajar dapat didefinisikan sebagai alat atau prosedur sistematik untuk mengukur hasil belajar siswa (Cece Rakhmat dan Didi Suherdi, 1998/1999:67). Suatu kemajuan program pendidikan dibuktikan dengan peningkatan hasil yang diperoleh yang dapat dilihat dari hasil tes belajar. Meskipun fungsi utama dari tes hasil belajar adalah mengukur prestasi belajar siswa, bukan berarti tes hasil belajar semata-mata untuk memberikan angka di rapor. Umpan balik dari diadakannya tes hasil belajar adalah nilai. Anggapan yang salah adalah jika siswa beranggapan bahwa nilai menjadi tujuan utama dalam belajar, yang terkadang dicapai dengan cara apapun. Dengan demikian, tes tersebut akan Indonesia National Assessment Programme (INAP) 50

51 memberikan hasil yang tidak sesuai dengan apa yang hendak diukur. Tes hasil belajar diharapkan mampu menjadi motivator siswa dalam belajar. Bentuk soal yang biasa dipakai dalam tes adalah soal pilihan ganda dan soal uraian. Keunggulan soal pilihan ganda yaitu dapat diskor dengan mudah, cepat, serta objektif dan mencakup ruang lingkup materi yang luas dalam suatu tes. Soal pilihan ganda menuntut peserta tes untuk memberikan jawaban atas pertanyaan atau pernyataan yang tercantum dalam pokok soal atau stem yang disertai dengan sejumlah kemungkinan jawaban. Pilihan jawaban terdiri atas jawaban yang benar yang disebut kunci jawaban, serta kemungkinan jawaban salah yang dinamakan pengecoh (distractor). Tugas peserta tes adalah memilih salah satu diantara jawaban yang tersedia, yang benar atau yang paling benar. Menurut Sumarna Surapranata (2004:133), bentuk soal pilihan ganda dibedakan menjadi dua macam yaitu bentuk soal dengan pokok soal (stem) pertanyaan dan bentuk soal dengan pokok soal (stem) pernyataan. Pada soal pilihan ganda berbentuk pertanyaan, stem disajikan dengan tanda tanya dan langsung ke arah permasalahan, sedangkan pada soal pilihan ganda berbentuk pernyataan, stem disajikan dengan empat buah titik di akhir kalimat yang terdapat pada stem atau dengan tiga buah titik (di awal kalimat atau di tengah kalimat). Menurut Ruseffendi (1991: 21), tipe soal yang cocok untuk assessment proses belajar siswa dalam mengerjakan soal sebagai suatu bentuk pengukuran hasil belajar adalah soal yang bertipe uraian atau essay. Pada dasarnya tes uraian adalah pertanyaan yang menuntut siswa menjawab dalam bentuk menguraikan, menjelaskan, mendiskusikan, membandingkan, memberikan alasan, dan bentuk lain yang sejenis sesuai dengan tuntutan pertanyaan dengan menggunakan katakata dan bahasa sendiri. Maka dalam tes uraian dituntut kemampuan siswa untuk menggeneralisasikan gagasannya melalui bahasan tulisan (Nana Sujana, 1992:35). Tipe essay test lebih bersifat power test. Pada tes ini hasil penilainnya relatif tergantung penilainya. Karena itu tes uraian ini subjektif. Tujuan utama tes berbentuk uraian adalah agar siswa dapat menunjukkan proses jawaban secara terperinci, tidak hanya hasil, misalnya membuktikan dan menghitung. Indonesia National Assessment Programme (INAP) 51

52 Selain itu, tes uraian bisa digunakan untuk melatih ingatan dan kreativitas siswa dalam mengolah suatu jawaban. Kelebihan dari tes tertulis adalah: (a) Menyusunnya mudah, (b) Siswa bebas menjawab, (c) Siswa dilatih megemukakan pendapat, (d) Mudah disiapkan dan disusun, (e) Siswa tidak mudah berspekulasi, (f) Mendorong siswa untuk dapat mengemukakan pendapat dan serta menyusun dalam kalimat yang baik, (g) Ekonomis, karena menggunakan kertas yang sedikit. Adapun kelemahan tes uraian adalah: (a) Kadar validitas dan reliabilitas rendah, (b) Scope yang dinilai sempit, (c) Pemeriksaan yang sulit dan subjektif, (d) Hanya dapat diperiksa oleh penyusun tes atau pihak lain yang menguasai bidang yang sama, (e) Jawabannya heterogen, sehingga menyulitkan tester, (f) Baik-buruk tulisan, panjang pendek, tidak sama jawaban menimbulkan penskoran kurang objektif, dan (g) Adanya salah pengertian dalam memahami soal tes. Adapun cara mengatasi kelemahan tes uraian dapat dilakukan dengan cara: (a) Hendaknya penulis soal menentukan batasan jawab yang diharapkan agar jawaban tes tidak terlalu beraneka ragam, (b) Bahasa yang digunakan hendaknya seefisien mungkin, ringkas, tepat dan langsung pada permasalahan sehingga mudah dipahami oleh siswa, (c) Jika soal diambil dari buku, sebaiknya redaksinya dirubah menurut redaksi penulis soal, (d) Dalam pemeriksaan sebaiknya dilakukan pernomor soal bukan perorangan, (e) Untuk mengurangi subyektivitas, ada baiknya jika hasil pemeriksaan yang telah kita lakukan, kembali kita periksa untuk yang kedua kalinya setelah beberapa waktu tertentu, (f) Sebelum soal-soal tes diujikan, kita membuat dulu kunci jawaban atau penyelesaiannya, atau paling tidak pokok-pokok jawabannya. Dalam mata pelajaran matematika dapat dibuat perkiraan skor atau nilai tertentu untuk setiap tahap penyelesaian yang diberikan oleh siswa. Langkah ini dimaksudkan agar setiap siswa mendapat nilai yang sesuai dengan langkah-langkah pengerjaannya yang benar. Terkait dengan penyusunan tes uraian agar diperoleh soal-soal yang berkualitas, perlu diperhatikan beberapa hal berikut ini: a. Hendaknya tes meliputi ide-ide pokok bahan yang akan diteskan. Indonesia National Assessment Programme (INAP) 52

53 b. Soal tidak sama persis dengan contoh yang ada pada catatan. c. Pada waktu menyusun soal, hendaknya juga dibuatkan kunci jawaban. d. Pertanyaan menggunakan kata tanya yang bervariasi. e. Hendaknya rumus yang digunakan dalam menjawab soal jelas dan mudah dipahami. f. Hendaknya ditegaskan model jawaban yang dikehendaki oleh pembuat, untuk itu harus spesifik dan tidak terlalu umum. F. Ragam Bentuk Soal Soal adalah serangkaian tugas yang harus dikerjakan atau dijawab oleh peserta didik, suatu soal terdiri atas sejumlah butir soal. Ciri khusus soal ialah selalu mempunyai jawaban benar atau salah. Pekerjaan atau jawaban peserta didik tersebut setelah diperiksa benar-salahnya akan menghasilkan skor yang selanjutnya dengan cara tertentu diubah menjadi nilai. Soal dibagi menjadi dua bentuk, yaitu soal bentuk uraian dan soal bentuk objektif. Kedua bentuk soal memiliki kelebihan disamping kekurangan. Pemilihan bentuk soal yang tepat ditentukan oleh tujuan ujian, jumlah peserta ujian, waktu yang tersedia untuk memeriksa lembar jawaban, cakupan materi, dan karakteristik mata pelajaran yang diujikan (Djemari Mardapi, 2008: 91). 1. Soal Bentuk Uraian Instrumen penilaian hasil belajar bentuk soal adalah instrumen untuk merekam hasil belajar peserta didik. Hasil belajar merupakan manifestasi tujuan belajar dalam bentuk kompetensi belajar. Oleh karenanya hasil belajar peserta didik berupa kompetensi hasil belajar, yang berisi dua hal: a. kompetensi aspek kognitif, afektif, dan/atau psikomotor; b. materi kimia dalam bentuk pengetahuan faktual, konseptual, prosedural, dan/atau meta kognitif. Pada soal bentuk uraian, butir soal berbentuk kalimat dan peserta didik harus menjawab dalam bentuk kalimat pula. Atas dasar hal ini, peserta didik harus memiliki kemampuan menulis kalimat dengan cara dan bahasa ilmiah yang benar. Indonesia National Assessment Programme (INAP) 53

54 Pada soal bentuk objektif, butir soal berupa pertanyaan atau pernyataan dan diikuti dengan sejumlah alternatif jawaban. Peserta didik menjawab butir soal dengan memilih alternatif jawaban yang sudah disediakan Soal bentuk uraian terdiri atas butir-butir soal uraian. Butir soal uraian yang dimaksud di sini adalah butir soal yang mengandung pertanyaan yang jawabannya harus dilakukan dengan cara mengekspresikan pikiran peserta didik. Pada butir soal bentuk uraian tidak tersedia alternatif jawaban. Dalam menjawab butir soal uraian peserta didik dituntut untuk menguraikan jawabannya dengan kata-kata sendiri dan cara sendiri. Jawaban dari peserta didik selalu berbeda dalam hal bentuk, cara, dan gaya bahasanya. Soal uraian disebut soal non objektif, karena penilaian yang dilakukan terhadap hasil ujian dengan soal bentuk ini cenderung dipengaruhi subjektivitas dari penilai (unsur pribadi penilai). Bentuk soal ini menuntut kemampuan peserta didik untuk menyampai-kan, memilih, menyusun, dan memadukan gagasan atau ide yang telah dimilikinya dengan menggunakan kata-katanya sendiri. Soal bentuk uraian memiliki kelebihan dibandingkan soal bentuk objektif, baik dalam cara penyusunannya maupun pelaksanaannya. Keunggulan bentuk soal ini dapat mengukur tingkat berpikir dari yang rendah sampai yang tinggi, yaitu mulai dari aspek kognitif mengingat sampai mengevaluasi. Kelebihan lainnya adalah: a. cara menyusunnya lebih mudah daripada soal objektif, b. mengukur hasil belajar kompleks, yang tidak dapat diukur dengan soal objektif, c. peserta didik tidak dapat menebak jawaban. Namun disamping kelebihan yang dimilikinya, soal uraian juga memiliki berbagai kekurangan, diantaranya: a. untuk koreksi diperlukan waktu lama, b. materi yang dicakup sangat terbatas, c. subjektivitas tinggi, d. reliabilitas rendah Untuk mengurangi subjektivitas yang tinggi, ada beberapa cara yang dapat ditempuh, yaitu: Indonesia National Assessment Programme (INAP) 54

55 a. jawaban tiap soal tidak dituntut terlalu panjang, sehingga dapat mencakup materi yang banyak, b. tidak melihat nama peserta ujian, c. memeriksa tiap butir soal dalam waktu bersamaan atau sesuai nomor soal, sehingga jika penilai kelelahan dalam mengoreksi dapat berhenti di nomor soal yang sama. Hal ini dilakukan karena suasana hati penilai sangat berpengaruh dalam menilai, dan d. menyiapkan pedoman penskoran dalam bentuk tabel penskoran atau marking scheme untuk setiap butir soal uraian yang berupa tahap-tahap perhitungan, sedangkan jika jawaban soal bersifat argumentatif, maka harus ditetapkan kata kunci yang harus ada dalam jawaban. Soal uraian dibagi menjadi tipe uraian terbatas dan uraian bebas. Pada tipe soal uraian terbatas, jawaban peserta didik dibatasi rambu-rambu yang ditentukan dalam butir soal uraian tersebut. Jawaban peserta didik bersifat memusat (konvergen). Ragam soal ini ada tiga yaitu ragam soal uraian melengkapi (isian), ragam soal uraian jawaban singkat, dan ragam soal uraian terbatas sederhana. Pada tipe soal uraian bebas, peserta didik bebas menjawab soal dengan cara dan sistematika sendiri. Jawaban peserta didik terhadap soal tersebut bersifat menyebar (divergen). Ragam butir soal ini ada dua, yaitu ragam soal uraian bebas sederhana dan ragam soal uraian bebas ekspresif. Pemberian skor soal uraian melengkapi dan jawaban singkat, cara menskornya sederhana. Skor tiap butir soal untuk jawaban benar adalah 1 (satu) dan skor tiap butir soal untuk jawaban salah adalah 0 (nol). Pemberian skor soal uraian terbatas sederhana, soal uraian bebas sederhana dan uraian bebas ekspresif, perlu dibuat cara penskorannya dengan suatu tabel penskoran atau marking scheme. Setiap langkah yang dijawab benar diberi skor, sehingga penskoran menjadi lebih objektif. Dalam menyusun soal bentuk uraian, ada beberapa hal yang harus diperhatikan, diantaranya: a. Materi soal uraian merupakan materi yang tidak cocok diukur dengan soal objektif. Indonesia National Assessment Programme (INAP) 55

56 b. Setiap butir soal menggunakan petunjuk dan rumusan yang jelas dan mudah dipahami sehingga tidak menimbulkan kebimbangan pada peserta didik. c. Jangan memberikan kesempatan kepada peserta didik untuk memilih beberapa butir soal dari soal yang diberikan. d. Butir soal uraian mengarah pada aspek kognitif yang tinggi (C 2 ke atas). 2. Soal Bentuk Objektif Soal bentuk objektif terdiri atas sejumlah butir soal. Butir soal objektif adalah butir soal yang mengandung pertanyaan atau pernyataan yang alternatif jawabannya telah disediakan. Peserta didik diminta memilih salah satu alternatif jawaban yang benar. Bentuk soal objektif yang sering digunakan adalah bentuk pilihan ganda, benar salah, menjodohkan, dan uraian objektif. Soal uraian objektif sering digunakan pada bidang sains (IPA) dan teknologi atau bidang sosial yang jawabannya sudah pasti dan hanya satu jawaban yang benar. Sedangkan soal uraian non objektif (esai) sering digunakan pada bidang ilmu sosial, yaitu jika jawabannya luas dan tidak hanya satu jawaban yang benar, tergantung argumen-tasi peserta ujian. Bentuk soal objektif pilihan ganda dan benar salah sangat tepat digunakan bila jumlah peserta ujian banyak, waktu koreksi singkat, dan cakupan materi yang diujikan banyak. Bentuk soal uraian objektif sering digunakan pada mata pelajaran yang batasnya jelas, seperti mata pelajaran fisika, kimia, biologi, atau IPA terpadu, matematika, dan teknik. Soal pada ujian bentuk ini jawabannya hanya satu, mulai dari memilih rumus yang tepat, memasukkan angka dalam rumus, menghitung hasil, dan menafsirkan hasilnya. Soal uraian objektif penskorannya juga jelas dan rinci. Secara umum soal berbentuk objektif memiliki beberapa kelebihan, yaitu: a. cara mengoreksi jawaban mudah, cepat, dan dapat dilakukan oleh siapapun, b. materi pokok kimia yang dicakup luas, c. objektivitas tinggi. Indonesia National Assessment Programme (INAP) 56

57 Sedangkan kekurangan soal objektif antara lain: a. cara menyusunnya sukar dan lama, b. hanya sesuai untuk mengukur hasil belajar pada aspek kognitif tingkat rendah (mengingat), c. ada kemungkinan peserta didik menebak jawaban. Soal objektif dibagi menjadi tipe objektif benar-salah, objektif menjodohkan, dan objektif pilihan ganda. Jawaban soal objektif dapat diskor dengan mudah dan bersifat objektif. Umumnya dipakai dasar, bila jawaban butir soal benar skor adalah 1, sedangkan bila jawaban butir soal salah, skor adalah 0. Soal objektif bentuk pilihan ganda dapat digunakan untuk mengukur hasil belajar dari dimensi proses kognitif sederhana sampai dengan yang kompleks dan berkenaan dengan aspek mengingat, mengerti, mengaplikasi, menganalisis, mengevaluasi, dan mencipta. Butir soal objektif bentuk plihan ganda terdiri atas pokok soal dan alternatif pilihan jawaban. Pokok soal disebut juga stem, yang dapat berbentuk pertanyaan atau pernyataan yang belum sempurna. Pilihan jawaban dapat berbentuk perkataan, bilangan, atau kalimat, dan disebut juga option. Kelebihan soal bentuk pilihan ganda adalah lembar jawaban dapat diperiksa dengan komputer, sehingga objektivitas penskoran dapat dijamin. Namun membuat soal pilihan ganda yang baik tidak mudah, perlu tahapan validasi kualitatif dan kuantitatif yang harus ditempuh agar benar-benar diperoleh soal dengan kualitas yang baik, valid, dan reliabel. Soal berbentuk pilihan ganda memiliki kelebihan, diantaranya: a. cara penilaian dapat dilakukan dengan mudah, cepat, objektif, b. kemungkinan peserta didik menjawab dengan menebak dapat dikurangi, untuk option sebanyak 5 kemungkinan menebak adalah 20% dan option sebanyak 4 kemungkinan menebak adalah 25%, c. dapat digunakan untuk meneliti kemampuan peserta didik dalam menginterpretasi, memilih, dan menemukan pendapat, d. dapat digunakan berulang-ulang, dan Indonesia National Assessment Programme (INAP) 57

58 e. sangat cocok untuk menilai kemampuan peserta didik dalam mengaplikasikan prinsip-prinsip. Disamping kelebihan, soal berbentuk pilihan ganda memiliki kekurangan, yaitu: a. kebanyakan hanya digunakan untuk menilai ingatan, b. sukar menyusun soal yang benar-benar baik, c. memerlukan waktu dan tenaga yang banyak untuk menyusunnya. Dalam menyusun soal pilihan ganda,, ada beberapa hal yang harus diperhatikan, diantaranya: a. Berilah petunjuk mengerjakan soal yang jelas. b. Jangan memasukkan materi yang`tidak relevan dengan apa yang sudah dipelajari peserta didik. c. Pernyataan pada pokok soal (stem) seharusnya merumuskan persoalan yang jelas dan berarti. d. Pernyataan dan alternatif jawaban (option) hendaknya merupakan kesatuan kalimat yang tidak terputus. e. Option hendaknya homogen dalam hal materi dan panjangnya, urutan bilangan dari besar ke kecil atau sebaliknya. f. Panjang option pada suatu soal hendaknya lebih pendek daripada stem-nya. g. Usahakan agar stem dan option tidak mudah diasosiasikan. h. Dalam penyusunannya, pola kemungkinan jawaban yang benar hendaknya jangan sistematis. i. Harus diyakini bahwa hanya ada satu jawaban yang benar. G. Teori Respons Butir pada Data Dikotomi Pada analisis butir dengan teori respons butir ada asumsi yang harus dipenuhi untuk analisis ini yakni independensi lokal dan unidimensi. Pada teori ini, pendekatan probabilistik untuk menyatakan hubungan antara kemampuan peserta dengan harapan menjawab benar. Hubungan ini dinyatakan dengan model logistik Indonesia National Assessment Programme (INAP) 58

59 dengan parameter indeks kesukaran, indeks daya beda butir dan indeks tebakan semu (pseudoguessing). Pada model logistik tiga parameter dapat dinyatakan sebagai berikut (Hambleton, & Swaminathan, 1985 : 49; Hambleton, Swaminathan, & Rogers, 1991: 17; Baker, 2001 ). P i ( ) = c i + (1-c i ) Dai ( bi ) e Da ( ) 1 i b e i... (1) dengan tingkat kemampuan peserta tes, P ( ) probabilitas peserta tes yang i memiliki kemampuan dapat menjawab butir i dengan benar, a i indeks daya pembeda, bi indeks kesukaran butir ke-i, c i indeks tebakan semu butir ke-i, e bilangan natural yang nilainya mendekati 2,718, n banyaknya butir dalam tes, dan D faktor penskalaan yang harganya 1,7. Model 2 parameter dan model 3 parameter merupakan kasus khusus dari persamaan 1. Model 2 parameter merupakan kasus khusus dari model 3 parameter, yakni ketika c=0. Model 1 parameter merupakan kasus khusus model 1 parameter, yakni ketika a=1. Fungsi informasi butir (item information functions) merupakan suatu metode untuk menjelaskan kekuatan suatu butir pada perangkat soal dan menyatakan kekuatan atau sumbangan butir soal dalam mengungkap kemampuan laten (latent trait) yang diukur dengan tes tersebut (Hulin, C.L., Drasgow, F. & Parsons, C.K.,1983). Secara matematis, fungsi informasi butir didefinisikan sebagai berikut. I i ( ) = 2 ' Pi ( )... (2) P ( ) Q ( ) i i dengan i merupakan 1,2,3,,n, I i ( ) fungsi informasi butir ke-i, P i ( ) peluang peserta dengan kemampuan menjawab benar butir i, P' i ( ) turunan fungsi P i ( ) terhadap, Q i ( ) peluang peserta dengan kemampuan menjawab salah butir i. Fungsi informasi tes merupakan jumlah dari fungsi informasi butir-butir tes tersebut (Hambleton & Swaminathan, 1985: 94; De Gruijter, D.M. & van der Kamp, L.J.T., 2005). Berkaitan dengan hal ini, nilai fungsi informasi perangkat tes akan Indonesia National Assessment Programme (INAP) 59

60 tinggi jika butir-butir penyusun tes mempunyai fungsi informasi yang tinggi pula. Fungsi informasi perangkat tes (I( )) secara matematis dapat didefinisikan sebagai berikut. n I ( ) = I i ( )..... (3) i 1 H. Teori Respons Butir pada Data Politomi Selain model respons butir dikotomi, ada model lain yang dapat digunakan untuk menskor respons peserta terhadap suatu butir tes, yakni model politomi. Model-model politomi pada teori respons butir antara lain nominal respons model (NRM), rating scale model (RSM), partial credit model (PCM), graded respons model (GRM) dan generalized partial credit model (GPCM) (Van der Linden & Hambleton, 1997). Model respons butir politomous dapat dikategorikan menjadi model respons butir nominal dan ordinal, tergantung pada asumsi karakteristik tentang data. Model respons butir nominal dapat diterapkan pada butir yang mempunyai alternatif jawaan yang tidak terurut (ordered) dan adanya berbagai tingkat kemampuan yang diukur. Pada model respons ordinal terjadi pada butir yang dapat diskor ke dalam banyaknya kategori tertentu yang tersusun dalam jawaban. Skala Likert diskor berdasarkan pedoman penskoran kategori respons terurut, yang merupakan penskoran ordinal. Butir-butir tes matematika dapat diskor menggunakan sistem parsial kredit, langkah-langkah menuju jawaban benar dihargai sebagai penskoran ordinal. Model penskoran yang pang sering dipakai ahli yakni GRM, PCM, dan GPCM. 1. Graded Respons Model (GRM) Respons peserta terhadap butir j dengan model GRM dikategorikan menjadi m+1 skor kategori terurut, k=0,1,2,...,m dengan m merupakan banyaknya langkah dalam menyelesaikan dengan benar butir j, dan indeks kesukaran dalam setiap langkah juga terurut. Hubungan parameter butir dan kemampuan peserta Indonesia National Assessment Programme (INAP) 60

61 dalam GRM untuk kasus homogen (aj sama dalam setiap langkah) dapat dinyatakan oleh Muraki & Bock (1997:7) sebagai berikut. * * P ( ) P ( ) P ( )...(4) jk P jk jk j k 1 exp[ Da j ( b jk )] ( )...(5) 1 exp[ Da ( b )] j jk * * Dengan P ( ) 1 dan P ( ) =0 a j b jk j0 j m 1 : indeks daya beda butir j : kemampuan peserta, : indeks kesukaran kategori k butir j P jk ( ) : probabilitas peserta berkemampuan yang memperoleh skor kategori k pada butir j P * ( ) : probabilitas peserta berkemampuan yang memperoleh skor kategori k jk D atau lebih pada butir j : faktor skala 2. Partial Credit Model (PCM) PCM merupakan perluasan dari model Rasch, dengan asumsi setiap butir mempunyai daya beda yang sama. PCM mempunyai kemiripan dengan GRM pada butir yang diskor dalam kategori berjenjang, namun indeks kesukaran dalam setiap langkah tidak perlu terurut, suatu langkah dapat lebih sukar dibandingkan langkah berikutnya. Bentuk umum PCM menurut Muraki & Bock (1997:16) sebagai berikut. P jk h 0 k exp ( b jv ) v 0 ( ), k=0,1,2,...,m m k exp ( b ) v 0 jv Indonesia National Assessment Programme (INAP) 61

62 Dengan P jk ( ) = probabilitas peserta berkemampuan memperoleh skor kategori k pada butir j, : kemampuan peserta, m+1 : banyaknya kategori butir j, b jk : indeks kesukaran kategori k butir j k h 0 h ( b jh ) 0 dan ( b jh ) ( b jh ).(6) h 0 h h 1 Skor kategori pada PCM menunjukkan banyaknya langkah untuk menyelesaikan dengan benar butir tersebut. Skor kategori yang lebih tinggi menunjukkan kemampuan yang lebih besar daripada skor kategori yang lebih rendah. Pada PCM, jika suatu butir memiliki dua kategori, maka persamaan 5 menjadi persamaan model Rasch. Sebagai akibat dari hal ini, PCM dapat diterapkan pada butir politomus dan dikotomus. 3. Generalized Partial Credit Model (GPCM) GPCM menurut Muraki (1997) merupakan bentuk umum dari PCM, yang dinyatakan dalam bentuk matematis, yang disebut sebagai fungsi respons kategori butir sebagai berikut. dan P jh h exp Z jr ( ) v 0 ( ), k=0,1,2,...,m m j i e exp Z jr ( ) e 0 v 0...(7) Z jh ( )=Da j ( -b jh )=Da j ( -b j +d h ), b j0 =0...(8) Dengan Indonesia National Assessment Programme (INAP) 62

63 P jk ( ) : probabilitas peserta berkemampuan memperoleh skor kategori k pada butir j, : kemampuan peserta, a j : indeks daya beda butir j, b jh : indeks kesukaran kategori k butir j, b j : indeks kesukaran lokasi butir j (parameter butir lokasi) d k : parameter kategori k, m j +1 : banyaknya kategori butir j, dan D : faktor skala (D=1.7) Parameter b jh oleh Master dimamai dengan parameter tahap butir. Parameter ini merupakan titik potong antara kurva P jk ( ) dengan P jk-1 ( ). Kedua kurva hanya berpotongan di satu titik pada skala. Jika = b jk, maka P jk ( ) = P jk-1 ( ) Jika > b jk, maka P jk ( ) > P jk-1 ( ) Jika < b jk, maka P jk ( ) < P jk-1 ( ), K=1,2,3,...,m j I. Kecocokan Model Kemampuan peserta tes sebanyak N dinyatakan dengan yang merupakan skaa kontinu. Metode expected a posteriori (EAP) digunakan sebagai estimator untuk setiap kemampuan peserta. Menurut Du Toit (2003) estimasi EAP merupakan rerata dari distribusi posterior dari dengan diberikan pola respons terobservasi x i. Skor EAP didekati dengan titik quadrature (quadrature point) X f dan bobot A(X f ) yakni F f X f Ll ( X f ) A( X f ) 1 l F...(9) L ( X ) A( X ) f 1 l f f Dengan L X ) merupakan probabilitas dari pola respons xi. Standar deviasi l ( f posterior dari skor EAP didekati dengan Indonesia National Assessment Programme (INAP) 63

64 PSD( l ) = F f 1 ( X ) f F f 1 l l 2 L ( X L ( X f l f ) A( X ) A( X f ) f )...(10) Setelah semua skor EAP peserta tes dikelompokkan pada suatu interval yang telah di perdeterminasikan H interval pada skala kontinu, frekuensi terobservasi dari respons kategori ke-k pada butir j dalam interval h yakni r hjk dan banyaknya peserta tes yang mengerjakan butir j dalam h interval yakni N hj dihitung. Skala kemampan yang telah diestimasi diskalakan sehingga varians dari distribusi sampel sama pada distribusi laten dari estimasi MML parameter butir yang selalu diset berdistribusi normal N(0,1). H dengan m j +1 tabel kontingensi untuk setiap butir ke-j. Untuk setiap interval, dihitung rerata interval h dan nilai fungsi respons yang cocok P ). Statistik jk ( h 2 perbandingan likelihood untuk setiap butir dihitung dengan G 2 j 2 H j m j r hjk h 1 k 0 ln N hj r P hjk jk ( ) h...(11) Dengan H j merupakan banyaknya interval setelah interval dengan nilai frekuensi kurang dari 5 digabung dengan interval terdekat. Derajat kebebasan sama dengan banyaknya interval H j dikalikan dengan m j. Statistik uji likelihood untuk tes keseluruhan merupakan jumlahan dari statistik uji 2 perbandingan 2 secara terpisah. Derajat kebebasan ini juga merupakan jumlahan dari derajat kebebasan dari tiap butir. Uji kecocokan ini digunakan untuk mengevaluasi kecocokan model pada data respons yang sama ketika model tersarang pada parameter-parameternya. Untuk mengetahui perbandingan model, menurut Thissen et. al. (1993: 72) dan Camilli dan Shepard (1994 : 76) dapat digunakan dengan metode perbandingan likelihood dalam teori respons butir (IRT-LR). Langkahlangkah untuk melakukan perbandingan likelihood sebagai berikut. Misalkan L * merupakan nilai fungsi likelihood L. Ada dua model yang akan diperbandingkan, model C, yaitu model kompak (compact) dan Indonesia National Assessment Programme (INAP) 64

65 model A, yaitu model yang ditingkatkan (augmented). Model C merupakan model yang lebih sederhana. Kemudian dirumuskan hipotesis : H o : = Set C ( Set C memuat N parameter) (12) H a : = Set A ( Set A memuat N+M parameter)... (13) dianggap memiliki set parameter yang benar. Model C memiliki M parameter lebih sedikit dibandingkan dengan model A. Perbandingan likekihood (Likelihood Ratio, LR) untuk dua model dinyatakan dengan persamaan : LR = dengan: L L * ( C ) ( A).... (14) * L (C) : nilai fungsi likelihood model C * L ( A) ] : nilai fungsi likelihood model A. Kemudian ditransformasikan dengan logaritma natural : dengan: 2 (M ) = -2 ln(lr) =[-2 ln L * (C) ]-[-2ln L * ( A) ]... (15) * L (C) : nilai fungsi likelihood model C * L ( A) ] : nilai fungsi likelihood model A. Agar lebih mudah, G(C) = [-2 ln L * (C) ] dan G(A) =[-2ln L * ( A) ], sehingga 2 (M ) rasio/perbandingan logaritma likelihood menjadi = -2ln(LR) = G( C) G(A).. (16) Persamaan 16 tersebut berdistribusi khi-kuadrat dengan M derajat kebebasan. Indonesia National Assessment Programme (INAP) 65

66 J. Variabel yang Diukur Variabel yang diukur dalam survei INAP terdiri dari pengetahuan (knowledge), keterampilan (skill), serta latar belakang peserta didik, guru, dan sekolah. 1. Pengetahuan dan Keterampilan Pengetahuan yang diukur berupa materi yang terdapat dalam kurikulum (curriculum focused) dan materi yang bersifat lintas kurikulum (cross-curricular elements) dengan penekanan pada pemahaman konsep dan kemampuan untuk menggu-nakannya dalam kehidupan pada berbagai situasi. Pengetahuan dan keterampilan yang diukur meliputi: a. Literasi membaca (reading literacy), meliputi: (1) kemampuan membaca (performative), (2) kemampuan menggunakan bahasa untuk memenuhi kebutuhan hidup sehari-hari (functional), (3) kemampuan mengakses pengetahuan dengan bahasanya (informational), dan (4) kemampuan mentransformasi pengetahuan serta mengeva-luasi (epistemic). a. Literasi matematika (mathematical literacy), meliputi: (1) kemampuan mengetahui fakta dan prosedur matematika (knowing), (2) kemampuan menggunakan konsep matematika untuk menjawab permasalahan matematis sederhana (using), (3) dan kemampuan bernalar untuk memecahkan masalah yang membutuhkan pemikiran matematis (reasoning). b. Literasi sains (scientific literacy), mencakup kemampuan: 1) menggunakan pengeta-huan atau konsep-konsep sains secara bermakna, 2) mengidentifikasi masalah, 3) menganalisis dan mengevaluasi data atau peristiwa; 4) merancang penyelidikan; 5) menggunakan dan memanipulasi alat, bahan atau prosedur; serta 6) memecahkan masalah dalam rangka memahami fakta-fakta tentang alam dan perubahan yang terjadi dalam kehidupan. Indonesia National Assessment Programme (INAP) 66

67 2. Latar Belakang Peserta Didik, Guru, dan Sekolah a) Latar Belakang Peserta Didik Berdasarkan penggalian latar belakang peserta didik akan dicari informasi mengenai: demografi peserta didik, latar belakang status sosial dan ekonomi, tingkat motivasi dan minat peserta didik, partisipasi lingkungan peserta didik terhadap pendidikan, kebiasaan belajar peserta didik, persepsi peserta didik terhadap bidang studi yang diujikan, serta ekspektasi (harapan) peserta didik terhadap hasil pembelajaran. b) Latar Belakang Guru Setiap guru yang mengajar peserta didik yang menjadi sampel pada INAP akan diberikan angket yang mengukur aspek-aspek: demografi guru, pengalaman mengajar, latar belakang pendidikan dan pelatihan, alokasi waktu guru dalam mengajar, opini dan persepsi guru terhadap sekolah dan peserta didik, serta kesiapan guru mengajarkan materi yang diujikan. c) Latar Belakang Sekolah Aspek yang diukur yang berkaitan dengan latar belakang sekolah meliputi: demografi sekolah, jumlah peserta didik dan guru, latar belakang pendidikan semua guru, status semua guru (tetap atau honorer), kebijakan sekolah dalam penerimaan peserta didik, sumber dana sekolah dan pengalokasiannya, kebijakan pembelajaran di sekolah (penentuan mata pelajaran, buku yang digunakan), dan variabel-variabel lain yang berhubungan dengan pengelolaan sekolah. K. Strategi Asesmen Strategi asesmen yang ditempuh dalam INAP adalah dengan cara survei yang menggunakan metodologi, prosedur, dan mekanisme yang diadaptasi dari beberapa survei Internasional yang telah dilakukan, antara lain Programme for International Students Assessment (PISA) oleh Organization for Economics Cooperation Development (OECD), Trends in International Mathematics and Science Study (TIMSS), dan Programme for International Reading Literacy Study Indonesia National Assessment Programme (INAP) 67

68 Tabel 4. SK dan KD IPA Kelas IV SD/MI Berdasarkan Standar Isi Semester Jumlah SK Nomor SK Perincian KD Jumlah KD (PIRLS) oleh International Evaluation Assessment (IEA), National Assessment of Educational Progress (NAEP). Setiap rangkaian survei INAP diawali dengan pengembangan kerangka kerja, pengembangan instrumen yang dilaksanakan dengan memenuhi kaidah psikometrik, pemilihan sampel sekolah, pengumpulan data, pengolahan data, serta pelaporan. Di setiap tahapan, pelaksanaan dilaksanakan dengan mematuhi rambu-rambu yang diadaptasi dari prosedur kerja survei internasional. Pusat Penilaian Pendidikan (Puspendik) adalah institusi yang mengkoor-dinir semua kegiatan INAP. Dalam pelaksanaannya Puspendik dibantu oleh Dinas Pendidikan terkait dan juga bekerjasama dengan Institusi Perguruan Tinggi di Indonesia. L. Siklus Asesmen Survei INAP merupakan survei tahunan yang target keseluruhannya adalah memantau pencapaian hasil pendidikan dari kelas I hingga kelas XII. Tahun 2011, kemampuan yang diukur dalam survei INAP adalah penguasaan domain konten dan kognitif kelas IV, serta latar belakang peserta didik, guru, dan sekolah yang menentukan keberhasilan peserta didik. Diharapkan dalam jangka waktu enam tahun, survei INAP telah mencapai satu siklus penuh dari kelas I hingga kelas XII. Indonesia National Assessment Programme (INAP) 68

69 BAB III METODOLOGI PENELITIAN A. Target Populasi Populasi dari survei INAP adalah seluruh peserta didik kelas V SD/MI di Kabupaten Deli Serdang, Sumatera Utara dan Kabupaten Karawang, Jawa Barat. Di setiap jenjang sekolah, target populasi INAP mencakup sekolah Negeri dan Swasta; sekolah baik, sedang dan kurang berdasar hasil UN SD. B. Sampel Teknik sampling yang digunakan adalah multi-stages stratified probability proportional to size sampling. Di setiap provinsi sekolah yang menjadi target populasi diklasifikasikan berdasar tiga jenis strata (stratified): (1) jenis sekolah (SD/MI), (2) status sekolah (Negeri dan Swasta), dan (3) mutu sekolah (baik, sedang, kurang). Kriteria sekolah berdasarkan nilai rata-rata sekolah pada soal-soal linking Nasional UN SD. Di setiap Provinsi, ditentukan sekolah-sekolah yang memenuhi kriteria, yaitu lokasi terjangkau, jumlah peserta didik terdaftar memadai untuk pengambilan data (>7 peserta didik per sekolah), serta mencakup minimal 95% total populasi peserta didik di Provinsi tersebut. Sekolah dikelompokkan berdasarkan setiap strata dan diurutkan berdasarkan jumlah peserta didik terdaftar di masing-masing sekolah. Sebanyak 50 sekolah Provinsi terpilih sebagai sampel utama studi INAP 2013 dan setiap sekolah sampel utama disiapkan 2 sekolah cadangan. C. Instrumen Penelitian Instrumen yang digunakan dalam survei ini terdiri atas tes dan angket. Tes digunakan untuk mengukur prestasi peserta didik dan angket digunakan untuk mendapatkan informasi tentang variabel-variabel yang mempengaruhi prestasi peserta didik, yang meliputi variabel peserta didik, guru, sekolah, dan proses belajarmengajar. Setiap peserta didik akan menempuh tes Matematika, Bahasa Indonesia, dan IPA. Indonesia National Assessment Programme (INAP) 69

70 Berdasarkan jenis mata pelajaran yang diujikan, terdapat dua macam buku tes, yaitu: (1) buku tes Matematika dan membaca, dan (2) buku tes Ilmu Pengetahuan Alam (IPA). Masing-masing buku tes terdiri atas 8 buku tes, sehingga jumlah buku tes keseluruhan adalah 16 buku tes. Antarbuku tes tersebut terdapat soal yang sama (anchor item) yang bertujuan untuk menyetarakan kemampuan peserta didik dalam satu skala, meskipun menempuh buku tes yang berbeda. Buku tes INAP didesain dengan mengikuti matriks pemetaan soal. Untuk setiap jenjang sekolah, soal-soal dari setiap mata pelajaran dikelompokkan dalam 8 cluster soal. Setiap buku tes terdiri atas 4 cluster soal yang berasal dari mata pelajaran yang berbeda. Pengaturan cluster dalam setiap buku tes dapat dilihat dalam Tabel 5 dan Tabel 6. Tabel 5. Pemetaan Cluster Soal dalam Setiap Buku Tes Matematika dan Membaca BUKU 1 BIN INT 1 (1-13) BUKU 2 MAT CLUSTER 2 (1-14) BUKU 3 BIN CLUSTER 3 (1-13) BUKU 4 MAT INT 1 (1-10) BUKU 5 BIN INT 2 (1-11) BUKU 6 MAT CLUSTER 4 (1-14) BUKU 7 BIN CLUSTER 5 (1-12) BUKU 8 MAT CLUSTER 6 (1-13) BUKU 9 BIN CLUSTER 1 (1-14) BIN CLUSTER 1 (14-27) MAT INT 2 (15-25) BIN CLUSTER 2 (14-26) MAT CLUSTER 3 (11-24) BIN CLUSTER 4 (12-25) MAT CLUSTER 5 (15-28) BIN INT 1 (13-25) MAT INT 2 (14-24) BIN CLUSTER 6 (15-27) MAT INT 1 (28-37) BIN CLUSTER 2 (26-38) MAT CLUSTER 3 (27-40) BIN INT 1 (25-37) MAT INT 2 (26-36) BIN CLUSTER 4 (29-42) MAT CLUSTER 5 (26-39) BIN CLUSTER 6 (25-37) MAT CLUSTER 1 (28-42) MAT CLUSTER 1 (38-52) BIN INT 2 (39-49) MAT CLUSTER 2 (41-54) BIN CLUSTER 3 (38-50) MAT CLUSTER 4 (37-50) BIN CLUSTER 5 (43-54) MAT INT 1 (40-49) BIN INT 2 (38-48) MAT CLUSTER 6 (43-55) Indonesia National Assessment Programme (INAP) 70

71 Tabel 6. Pemetaan Cluster Soal dalam Setiap Buku Tes IPA BUKU 10 IPA INT 1 (1-10) BUKU 11 IPA CLUSTER 2 (1-12) BUKU 12 IPA CLUSTER 3 (1-12) BUKU 13 IPA INT 1 (1-10) BUKU 14 IPA INT 2 (1-11) BUKU 15 IPA CLUSTER 4 (1-11) BUKU 16 IPA CLUSTER 5 (1-12) BUKU 17 IPA CLUSTER 6 (1-12) BUKU 18 IPA CLUSTER 1 (1-12) IPA CLUSTER 1 (11-22) IPA INT 2 (13-23) IPA CLUSTER 2 (13-24) IPA CLUSTER 3 (11-22) IPA CLUSTER 4 (12-22) IPA CLUSTER 5 (12-23) IPA INT 1 (13-22) IPA INT 2 (13-23) IPA CLUSTER 6 (13-24) Sementara itu, angket yang digunakan dalam survei ini terdiri atas satu angket peserta didik, tiga angket guru (guru Matematika, guru Bahasa Indonesia, guru IPA), dan satu angket sekolah. D. Strategi Pengumpulan Data Dalam survei INAP ini digunakan buku tes dan angket. Buku tes digunakan untuk mengukur prestasi peserta didik dan angket digunakan untuk mendapatkan informasi tentang variabel-variabel yang mempengaruhi prestasi peserta didik, yang meliputi variabel peserta didik, guru, sekolah, dan proses belajar-mengajar. Indonesia National Assessment Programme (INAP) 71

72 E. Kerangka Kerja Pengembangan Instrumen Kerangka kerja pengembangan instrumen prestasi belajar mengacu pada (1) Standar Nasional Kompetensi Lulusan, (2) format item dan proses kognitif mengadopsi PIRLS, TIMSS, dan PISA. Kerangka kerja pengembangan instrumen angket peserta didilk, guru, dan sekolah mengacu pada PIRLS, TIMSS, PISA dan dikembangkan sesuai dengan kondisi di Indonesia Langkah-langkah yang dilakukan dalam kegiatan pengembangan instrumen INAP sebagai berikut: 1. Spesifikasi Tes Spesifikasi tes merupakan matriks yang memuat pokok-pokok bahasan, kompe-tensi, subkompetensi yang akan diukur, bentuk soal, jumlah soal, domain kognitif soal, dan indikator soal yang akan diukur dalam tes. 2. Pengembangan Butir Soal Butir soal dikembangkan dengan mengacu pada spesifikasi tes yang sudah ditetapkan. Soal yang telah disusun ditelaah secara kualitatif. Selanjutnya, validasi soal secara empiris dilakukan dengan mengujicobakan soal. Kemudian data dianalisis dengan menggunakan IRT untuk menentukan apakah suatu butir soal dapat dipakai, atau perlu direvisi, atau dibuang. Soal-soal yang dinyatakan baik (valid) dikalibrasi tingkat kesukarannya untuk kemudian disimpan dalam bank soal. Selanjutnya soal-soal yang ada dalam bank soal dapat digunakan untuk berbagai keperluan dalam mendesain tes. 3. Penyusunan Pedoman Pedoman yang digunakan dalam survei INAP terdiri dari 9 (sembilan) jenis manual, yaitu: (1) pedoman umum, (2) pedoman pengembangan instrumen, (3) pedoman koordinator sekolah, (4) pedoman administrator tes, (5) pedoman pelaksanaan survei, (6) pedoman entri data, (7) pedoman skoring, (8) pedoman analisis, dan (9) pedoman pemantau independen. Indonesia National Assessment Programme (INAP) 72

73 a. Pedoman Umum memuat tentang desain survei INAP, meliputi: (1) latar belakang, (2) tujuan, (3) ruang lingkup, (4) sampel survei, dan (5) pelaksanaan survei. b. Pedoman Pengembangan Instrumen, memuat: (1) penjelasan dari konstruk yang akan diukur, (2) spesifikasi instrumen, (3) pedoman penyusunan pengembangan item, (4) pedoman penelaahan, (5) pedoman uji coba, (6) pedoman analisis hasil uji coba, dan (7) pedoman kriteria pemilihan soal. c. Pedoman Koordinator Sekolah, meliputi: (1) peran koordinator sekolah, (2) tanggung jawab koordinator sekolah, (3) mengirimkan daftar peserta didik, (4) menentukan tanggal pelaksanaan tes, (5) mengkoordinasikan dan memberitahukan pelaksanaan tes, (6) mengkoordinasikan kegiatan dengan administrator tes, dan (7) menyebarkan dan mengumpulkan angket kepala sekolah dan guru. d. Pedoman Pelaksanaan Survei, meliputi: (1) metodologi pelaksanaan survei, (2) unsur-unsur yang terlibat dalam survei, (3) instrumen survei, (4) sampel survei, dan (5) kegiatan-kegiatan yang perlu dilakukan dalam survei. e. Pedoman Administrator Tes, meliputi: (1) peranan administrator tes, (2) persiapan pelaksanaan survei, (3) pelaksanaan survei, dan (4) penyusunan laporan pelaksanaan survei. f. Pedoman Entri Data, meliputi: (1) penyusunan data entry manager, (2) penyusunan pengembangan program entri data, dan (3) pedoman cleaning data. g. Pedoman Skoring, meliputi: (1) kerangka pedoman penkodean, (2) penetapan prinsip umum dalam pengkodean, (3) permasalahan dalam pengkodean, (4) kode-kode khusus, dan (5) kode dianulir. h. Pedoman Analisis, meliputi: (1) penetapan teknik analisis yang digunakan, (2) prosedur interpretasi hasil analisis, (3) pedoman pembobotan, dan (4) pedoman penanganan hasil analisis yang tidak lazim. i. Pedoman Pemantau Independen, meliputi: (1) latar belakang, (2) tujuan, (3) ruang lingkup, (4) sampel survei, (5) pedoman teknis pelaksanaan pemantauan, dan (6) pedoman penyusunan laporan hasil pemantauan. Indonesia National Assessment Programme (INAP) 73

74 F. Pelaksanaan Kegiatan Survei 1. Identifikasi Sampel Setelah sekolah sampel ditentukan, Puspendik mengirimkan surat pemberitahuan kepada Kepala Dinas Pendidikan Provinsi mengenai survei dan memberitahukan daftar sekolah sampel di masing-masing Provinsi. Selanjutnya, kontak person Provinsi menginformasikan kepada sekolah sampel mengenai survei INAP secara umum, mata pelajaran dan materi yang akan diujikan. Kontak person Provinsi juga menghubungi sekolah sampel untuk memperoleh daftar nama peserta didik pada target kelas. Kalau pada sekolah tersebut terdapat kelas paralel, Puspendik akan menentukan kelas mana yang menjadi kelas sampel. Selanjutnya daftar nama peserta didik yang terdaftar di kelas terpilih akan didokumetasikan oleh tim pengolah data di Dinas Pendidikan Provinsi ke dalam database daftar nama peserta didik. Selanjutnya Puspendik akan memberikan petunjuk bagaimana mengolah daftar nama peserta didik tersebut menjadi formulir identifikasi peserta didik, sehingga Dinas Pendidikan Provinsi dapat mengirimkan formulir tersebut kepada Kepala Sekolah untuk divalidasi. 2. Penggandaan dan Pengiriman Instrumen Instrumen digandakan sesuai dengan banyaknya sampel ditambah cadangan. Di setiap sampul instrumen terdapat kotak pengisian identitas sampel. Selain itu disiapkan pula label identifikasi sampel yang berisi kode standar dari Puspendik. Selanjutnya semua instrumen akan dikirimkan ke setiap Provinsi sesuai dengan jumlah sampel. 3. Pelatihan Administrator Tes Dinas Pendidikan Provinsi akan menentukan petugas Provinsi yang akan bertugas melaksanakan pengumpulan data di sekolah. Semua petugas tes harus mengikuti pelatihan Administrator Tes (AT) di Dinas Pendidikan Provinsi yang dikoordinir oleh tim INAP Provinsi. Selanjutnya petugas Provinsi berkoordinasi dengan kontak person di Dinas Pendidikan Kabupaten/Kota tentang mekanisme Indonesia National Assessment Programme (INAP) 74

75 pengumpulan data di sekolah sampel. Bahan-bahan survei dibawa oleh AT dari Dinas Pendidikan Provinsi untuk diujikan kepada peserta didik sampel dengan komitmen menjaga kerahasiaan. Pelaksanaan tes di sekolah sampel dilakukan oleh seorang AT. AT tidak hanya berasal dari staf Dinas Pendidikan Provinsi, tetapi memungkinkan juga menggunakan mahasiswa tingkat akhir, pengawas, atau dosen. AT ini ditentukan oleh kontak person dengan mematuhi kriteria dari Puspendik. AT di Provinsi dilatih oleh koordinator INAP Provinsi sebelum melaksanakan tes di sekolah sampel yang menjadi tanggung jawabnya. Koordinator INAP Provinsi membagi-kan bahan-bahan survei kepada AT sesuai dengan sekolah sampelnya. AT memeriksa kelengkapan bahan-bahan survei dan menandatangani berita acara serah terima. Semua bahan survei bersifat rahasia, sehingga AT perlu menandatangani surat pernyataan menjaga kerahasiaan. 4. Pelaksanaan Pengumpulan Data Sebelum hari pelaksanaan tes di sekolah, AT berkoordinasi dengan Kepala Sekolah berkaitan dengan jadwal pelaksanaan tes dan persiapan peserta didik yang menjadi sampel. AT melaksanakan tes dengan berpedoman pada manual administrator tes agar tes dapat dilaksanakan dengan cara yang sama di seluruh sekolah sampel. Adapun pembagian buku tes diatur sesuai Tabel 7. Bila jumlah peserta didik kurang dari 40 orang, buku tes yang tidak dipakai disimpan dan dipisahkan dari buku tes yang dipakai. Buku 1 Buku 9 Buku 8 Buku 7 Buku 6 Buku 2 Buku 1 Buku 9 Buku 8 Buku 7 Buku 3 Buku 2 Buku 1 Buku 9 Buku 8 Tabel 7. Pengaturan Buku Tes Buku 4 Buku 3 Buku 2 Buku 1 Buku 9 Buku 5 Buku 6 Buku 4 Buku 5 Buku 3 Buku 4 Buku 2 Buku 3 Buku 1 Buku 2 Buku 7 Buku 6 Buku 5 Buku 4 Buku 3 Buku 8 Buku 7 Buku 6 Buku 5 Buku 4 Indonesia National Assessment Programme (INAP) 75

76 Waktu untuk mengerjakan masing-masing buku tes adalah 120 menit dan angket peserta didik sekitar 35 menit. Tes dilaksanakan selama dua hari. Hari pertama, tes Matematika dan membaca. Hari kedua, tes fisika, biologi, dan kimia. Apabila ada peserta didik yang telah selesai sebelum waktu tes berakhir, peserta didik tidak diperbolehkan keluar ruangan. Angket peserta didik diberikan pada hari kedua setelah tes, sedangkan angket guru dan angket sekolah diberikan pada hari pertama. Guru yang mengisi angket adalah guru yang mengajar peserta didik yang menjadi sampel. Pada saat tes, peserta didik mengisi daftar hadir yang berisi nama peserta didik, nomor buku tes yang diterimanya (sesuai dengan format daftar hadir yang tersedia), sedangkan bagian identitas daftar hadir diisi oleh AT. Selain itu, AT juga membuat berita acara pelaksanaan tes. Setelah waktu tes berakhir, AT mengumpulkan dan menghitung kembali buku tes, serta mengurutkannya sesuai dengan urutan nomor absen peserta didik. Bila pelaksanaan survei di satu sekolah telah selesai, AT memeriksa kembali kelengkapan bahan-bahan dan kemudian bahan-bahan tersebut dibawa kembali ke Dinas Pendidikan Provinsi untuk diolah lebih lanjut oleh tim pengolah INAP Provinsi. Laporan pelaksanaan tes akan direkap oleh koordinator INAP Provinsi sebagai bahan laporan pelaksanaan ke Puspendik. 5. Pemilahan Data Bahan-bahan yang telah terkumpul dari semua sekolah sampel oleh tim Provinsi dipilah untuk keperluan penskoran dan pengentrian data. Sebelum dipilah, semua bahan dicek kelengkapannya. Selanjutnya, kode peserta didik pada dua buku tes dan angket yang ditempuh oleh seorang peserta didik dicek kesesuaiannya. Pengecekan ini dilakukan per sekolah dengan mengacu pada daftar hadir peserta didik. Apabila ditemukan kode peserta didik yang tidak sesuai, pemberkas melakukan penyesuaian atau pengkodean ulang. Setelah itu, angket peserta didik diikat kembali per sekolah, sedangkan angket guru dan angket sekolah diikat per Provinsi. Angket-angket tersebut dientri, sehingga diperoleh file data angket yang berisi identitas dan jawaban untuk tiap pernyataan dalam angket. Indonesia National Assessment Programme (INAP) 76

77 Buku-buku tes dari satu sekolah dipilah berdasarkan nomor buku tes, sehingga diperoleh 16 tumpukan buku tes. Hal ini dilakukan pada semua sekolah dalam satu Provinsi. Tiap tumpukan buku tes diikat dan diberi label yang berisi nama dan kode Provinsi, nomor buku tes, jumlah buku tes, nama dan kode penskor. Tumpukan buku tes ini siap diskor. 6. Penskoran Penskoran dilakukan oleh guru-guru mata pelajaran. Guru-guru ini dilatih terlebih dahulu mengenai metode penskoran soal-soal INAP agar mereka memi-liki pemahaman yang sama terhadap soal-soal uraian dan pedoman penskorannya. Setelah pelatihan, guru-guru tersebut bekerja secara individual dengan didampingi seorang koordinator bidang studi. Untuk memantau reliabilitas penskoran, beberapa buku diskor oleh dua orang penskor dan hasilnya dibandingkan. 7. Entri Data Data-data hasil survei dientrikan ke dalam komputer dengan menggunakan program data entry manager. Pengentri dilatih terlebih dulu agar dapat mengentrikan data INAP. Data yang dientrikan terdiri atas: buku tes, angket peserta didik, angket guru, angket sekolah, kehadiran peserta didik, dan laporan pelaksanaan tes. 8. Teknik Analisis Data File data hasil entri/scan yang berisi hasil penskoran setiap peserta didik dan setiap mata pelajaran dianalisis dengan model IRT 3 parameter logistic (1-PL) dan model generalized partial credit (GPCM), sedangkan file data hasil entri angket dianalisis dengan menggunakan analisis deskriptif perbandingan mean untuk melihat hubungan variabel dalam angket dengan kemampuan peserta didik. Indonesia National Assessment Programme (INAP) 77

78 BAB IV KEMAMPUAN MATEMATIKA, MEMBACA, SAINS SISWA DAN KARAKTER BUTIR A. Kemampuan Matematika, Membaca, Sains Terhadap Benchmark Internasional 1. Kemampuan Matematika Siswa Terhadap Benchmark Internasional Pada survey INAP, diujikan pula soal-soal studi internasional kelas 5 bidang studi matematika yang berasal dari studi Trend in International Mathematics and Science Study (TIMSS). Soal-soal internasional tersebut bersifat sebagai anchor kemampuan siswa target sampel INAP dengan rerata kemampuan internasional berdasarkan hasil TIMSS. Pada studi INAP 2013 ini digunakan 21 soal survey internasional dari total 105 butir soal atau sekitar 20%. Soal-soal internasional tersebut kemudian dianggap memiliki nilai item parameter yang tetap (fixed) sebagaimana dilaporkan pada hasil analisis internasional. Kemudian soal-soal INAP yang disusun di level nasional diklaibrasi terhadap soal-soal internasional tersebut. Hasil estimasi kemampuan siswa kemudian diskalakan ke dalam skala TIMSS dengan mean 500 dan standar deviasi 100. Berikut adalah hasil komparasi rerata skor matematika siswa DIY, Kaltim, Kerawang, Deli Serdang dalam studi INAP dibandingkan dengan negara Singapore, Jepang, Thailand, Iran, dan United States. Indonesia National Assessment Programme (INAP) 78

79 Skor Matematika RERATA SKOR mat INTERNASIONAL UNITED STATES IRAN THAILAND JEPANG SINGAPORE DELI SERDANG KERAWANG KALTIM DIY Gambar 4.1 Rerata Skor Matematika Dibandingkan Hasil TIMSS Terlihat pada gambar 4.1 bahwa DIY memiliki rerata skor lebih tinggi dibandingkan Kaltim, Kerawang, Deli Serdang namun masih berada di bawah rerata skor internasional. Meskipun demikian, hasil DIY dan Kaltim masih lebih baik dibandingkan dengan Thailand dan Iran. Kerawang mendapatkan skor terendah dibandingkan dengan DIY, Kaltim dan Deli Serdang. Kerawang juga mendapatkan nilai terendah dibandingkan dengan Singapore, Jepang, Thailand, Iran dan United States. Deli serdang lebih baik dari kerawang tapi tidak lebih baik dari DIY dan Kaltim. Deli serdang juga hasilnya lebih rendah dibandingkan dengan Singapore, Jepang, Thailand dan United States. Deli serdang hanya mampu mencapai hasil yang sama dengan Iran. Nilai DIY dan Kaltim memang terpaut jauh dibandingkan dengan Singapore, Jepang maupun United states, namun hasil INAP kedua provinsi tersebut tidak jauh dari rerata internasional. Hasil INAP Kerawang jauh dibawah rerata internasional begitu juga dengan hasil dari Deli Serdang Dengan melihat tabel 4.1 kita memperoleh informasi yang lebih dari sekedar perbandingan antar provinsi yang biasa kita peroleh dari hasil ujian nasional, namun kita juga mampu melakukan benchmark dengan negara lain. Dimana Kerawang Indonesia National Assessment Programme (INAP) 79

80 mendapatkan hasil terendah diikuti Deli Serdang yang hasilnya sama dengan Iran yang masih jauh di bawah rata-rata Internasiona; 2. Kemampuan Bahasa Siswa Terhadap Benchmark Internasional Hasil komparasi rerata skor membaca siswa DIY, Kaltim, Kerawang, Deli Serdang dalam studi INAP dibandingkan dengan negara Singapore, Jepang, Thailand, Iran, dan United States adalah sebagai berikut: 600 Skor Membaca RERATA SKOR read INTERNASIONAL UNITED STATES IRAN THAILAND JEPANG SINGAPORE DELI SERDANG KERAWANG KALTIM DIY Gambar 4.2 Rerata Skor Membaca Dibandingkan Hasil Internasional Terlihat pada gambar 4.2 bahwa DIY memiliki rerata skor lebih tinggi dibandingkan Kaltim, Kerawang, Deli Serdang namun masih berada di bawah rerata skor internasional. Meskipun demikian, hasil DIY dan Kaltim masih lebih baik dibandingkan dengan Jepang, Thailand dan Iran. Kerawang mendapatkan skor terendah dibandingkan dengan DIY, Kaltim dan Deli Serdang. Kerawang juga mendapatkan nilai terendah dibandingkan dengan Singapore, Jepang, Thailand, dan United States. Deli serdang lebih baik dari kerawang tapi tidak lebih baik dari DIY dan Kaltim. Deli serdang juga hasilnya lebih rendah dibandingkan dengan Singapore, Jepang, Thailand dan United States. Deli serdang mencapai hasil yang lebih baik dengan Iran. Kerwang dan Iran mendapatkan hasil paling terendah dan Indonesia National Assessment Programme (INAP) 80

81 jauh di bawah hasil Internasional. Nilai DIY dan Kaltim memang terpaut jauh dibandingkan dengan Singapore dan United States namun hasil INAP kedua provinsi tersebut tidak jauh dari rerata internasional. Hasil INAP Kerawang jauh dibawah rerata internasional begitu juga dengan hasil dari Deli Serdang Dengan melihat tabel 4.2 kita memperoleh informasi yang lebih dari sekedar perbandingan antar provinsi yang biasa kita peroleh dari hasil ujian nasional, namun kita juga mampu melakukan benchmark dengan negara lain. Dari hasil tersebut juga kita dapat mengatakan bahwa hasil kemampuan membaca Propinsi DIY, Kaltim dan Kabupaten Kerawang dan Deli Serdang masih jauh di bawah survey Internasional dan bahkan jauh dibawah dari Singapore dan United States 3. Kemampuan Sains Siswa Terhadap Benchmark Internasional Hasil komparasi rerata skor membaca siswa DIY, Kaltim, Kerawang, Deli Serdang dalam studi INAP dibandingkan dengan negara Singapore, Jepang, Thailand, Iran, dan United States adalah sebagai berikut: 600 Skor Sains RERATA SKOR sains INTERNASIONAL UNITED STATES IRAN THAILAND JEPANG SINGAPORE DELI SERDANG KERAWANG KALTIM DIY Gambar 4.3 Rerata Skor Membaca Dibandingkan Hasil Internasional Indonesia National Assessment Programme (INAP) 81

82 Terlihat pada gambar 4.3 bahwa DIY memiliki rerata skor lebih tinggi dibandingkan Kaltim, Kerawang, Deli Serdang. Hasil DIY dan Kaltim masih lebih baik dibandingkan dengan Thailand dan Iran dan bahkan di atas hasil skor internasional. Kerawang mendapatkan skor terendah dibandingkan dengan DIY, Kaltim dan Deli Serdang. Hasil Kerawang lebih tinggi dibandingkan dengan Thailand dan Iran. Deli serdang lebih baik dari kerawang tapi tidak lebih baik dari DIY dan Kaltim. Deli serdang juga hasilnya lebih rendah dibandingkan dengan Singapore, Jepang, dan United States tapi lebih baik dibandingkan dengan Thailand dan Iran.. Hasil INAP DIY, Kaltim melebihi hasil internasional begitu juga hasil Deli Serdang yang hamper menyamai hasil inetrnasional. Dengan melihat tabel 4.3 kita memperoleh informasi yang lebih dari sekedar perbandingan antar provinsi yang biasa kita peroleh dari hasil ujian nasional, namun kita juga mampu melakukan benchmark dengan negara lain. Dimana rata-rata kemampuan science DIY, Kaltim, Kerawang, Deli Serdang berada pada kategori baik karena tidak jauh dari hasil internasional bahkan DIY dan Kaltim lebih baik dari hasil internasional. B. Kemampuan Matematika, Membaca, Sains Siswa Deli Serdang Pada survei internasional TIMSS didefinisikan 5 benchmark internasional: Below Low (skor <400), Low (skor ), Intermediate (skor ), High (skor ), dan Advance (skor >625). Masing-masing benchmark didefinisikan sebagai berikut: Dekripsi kemampuan matematika pada setiap kategori benchmark: Advanced: siswa dapat mengaplikasikan pengetahuan dan pemahaman mereka akan konsep matematika dengan penjelasan yang rasional pada berbagai situasi yang kompleks High: siswa mampu mengaplikasikan pengetahuan dan pemahaman konsep matematika untuk memecahkan masalah Intermediate: Siswa mampu mengaplikasikan pengetahuan dasar matematika pada situasi yang sederhana Indonesia National Assessment Programme (INAP) 82

83 Low: Siswa memiliki pengetahuan dasar matematika. Kemampuan yang relatif dimiliki oleh siswa pada level ini adalah mampu menjumlah dan mengurangi bilangan bulat, mengenal konsep garis paralel dan berpotongan, familiar dengan bentuk geometri dan sumbu koordinat. Siswa pada level ini juga mampu membaca diagram batang dan tabel sederhana. Below Low: pengetahuan siswa akan konsep dasar matematika belum memadai Dekripsi kemampuan pemahaman bacaan pada setiap kategori benchmark: Advance: siswa mampu mengintegrasikan berbagai gagasan pada wacana serta memahami karakter tokoh, intensi, dan perasaan berdasarkan isi wacana. Siswa mampu menafsirkan bahasa yang figuratif serta mampu meneliti dan mengevaluasi struktur wacana tingkat awal. High : siswa mampu menentukan cuplikan cerita dan membedakan detail cerita yang terdapat pada wacana. Siswa mampu menginferensi isi wacana untuk menjelaskan kaitan antar tokoh, intensi, aksi, serta kejadian. Siswa mengenali penggunaan bahasa figuratif serta mulai mampu menginterpretasi jalan cerita. Intermediate: siswa mampu mengidentifikasi kejadian penting, urutan jalan cerita dan detail cerita yang relevan. Siswa mampu membuat inferensi sederhana tentang karakter, perasaan, dan motivasi tokoh utama serta mulai mampu membuat kaitan antar bagian wacana. Low: siswa mampu mengenali detail wacana yang tersaji secara explisit serta mampu menentukan bagian wacana yang spesifik dan sederhana. Below low: siswa belum mampu memahami isi wacana secara keseluruhan meskipun pada bagian yang eksplisit tersaji. Indonesia National Assessment Programme (INAP) 83

84 Dekripsi kemampuan sains pada setiap kategori benchmark: Advance: siswa mampu mengaplikasikan pemahaman akan proses sains dan menunjukkan pengetahuan inkuiri sains. High: siswa menunjukkan pemahaman konsep yang berkaitan dengan siklus, sistem, dan prinsip sains. Intermediate: siswa mampu mengaplikasikan pemahaman dasar tentang pengetahuan sains pada berbagai konteks. Low: siswa mengenal beberapa fakta dasar pada kehidupan seharihari yang berkaitan dengan sains biologi maupun fisika. Below low: siswa mengetahui konsep dasar dari biologi dan fisika namun tidak mampu mengaitkan dengan konteks sederhana di kehidupan nyata. Pada survei INAP selain diperoleh informasi mengenai posisi provinsi relatif terhadap provinsi lainnya ataupun negara lainnya, dapat diperoleh juga informasi mengenai hasil siswa yang ditentukan sebagai batasan antara satu kriteria/kategori dengan kriteria/kategori lainnya. Pada data ini dikelompokkan menjadi 5 (lima) kategori yaitu kategori ( below low, low, intermediate, high, advance). Indonesia National Assessment Programme (INAP) 84

85 1. Kemampuan Matematika Siswa Deli Serdang Hasil matematika siswa Deli Serdang berdasarkan kategori ( below low, low, intermediate, high, advance) adalah sebagai berikut: benchmark mathematics Frequency Valid Cumulative Valid below low ,9 38,9 38,9 low ,6 44,6 83,5 intermediate ,1 15,1 98,6 high 20 1,4 1,4 100,0 Total ,0 100,0 Tabel 4.1 Benchmark Matematika Siswa Deli Serdang Dari tabel di atas dengan jumlah peserta sebanyak 1419 sebanyak 552 peserta atau 38,9 % berada pada kategori below low, 633 peserta atau 44,6 % berada pada kategori low, 214 peserta atau 15,1 % berada pada kategori intermediate, dan 20 peserta atau 1,4 % berada pada kategori high. Sedangkan untuk kategori advanced tidak ada satupun peserta yang mencapai hasil tersebut. Frekuensi terbesar ada pada kategori low dan frekuensi yang paling sedikit ada pada kategori high. Secara umum siswa kita belum mampu menggunakan pengetahuan matematika yang dimilikinya untuk bernalar dalam memecahkan masalah. Data di atas dapat disajikan dalam bentuk diagram sebagai berikut: Indonesia National Assessment Programme (INAP) 85

86 Gambar 4.4 Benchmark Kemampuan Matematika Deli Serdang 2. Kemampuan Membaca Siswa Deli Serdang Hasil membaca siswa Deli Serdang berdasarkan kategori ( below low, low, intermediate, high, advance) adalah sebagai berikut: benchmark reading Frequency Valid Cumulative Valid below low ,0 68,0 68,0 low ,2 26,2 94,2 intermediate 78 5,5 5,5 99,7 high 4,3,3 100,0 Total ,0 100,0 Tabel 4.2 Benchmark Membaca Siswa Deli Serdang Indonesia National Assessment Programme (INAP) 86

87 Dari tabel di atas dengan jumlah peserta sebanyak 1419 sebanyak 965 peserta atau 68,0 % berada pada kategori below low, 372 peserta atau 26,20 % berada pada kategori low, 78 peserta atau 5,5 % berada pada kategori intermediate, dan 4 peserta atau 0,3 % berada pada kategori high. Sedangkan untuk kategori advanced tidak ada satupun peserta yang mencapai hasil tersebut. Frekuensi terbesar ada pada kategori below low dan frekuensi yang paling sedikit ada pada kategori high. Data di atas dapat disajikan dalam bentuk diagram sebagai berikut: Gambar 4.5 Benchmark Kemampuan Membaca Siswa Deli Serdang Indonesia National Assessment Programme (INAP) 87

88 3. Kemampuan Sains Siswa Deli Serdang Hasil sains siswa Deli Serdang berdasarkan kategori ( below low, low, intermediate, high, advance) adalah sebagai berikut: bechmark science Frequency Valid Cumulative Valid below low ,8 20,8 20,8 low ,0 38,0 58,8 intermediate ,4 31,4 90,2 high 127 8,9 8,9 99,2 advance 12,8,8 100,0 Total ,0 100,0 Tabel 4.3 Benchmark Sains Siswa Deli Serdang Dari tabel di atas dengan jumlah peserta sebanyak 1419 sebanyak 295 peserta atau 20,8 % berada pada kategori below low, 539 peserta atau 38,0 % berada pada kategori low, 446 peserta atau 31,4 % berada pada kategori intermediate, 127 peserta atau 8,9 % berada pada kategori high dan 12 atau 0,8% berada pada kategori advanced. Frekuensi terbesar ada pada kategori low dan frekuensi yang paling sedikit ada pada kategori advanced. Kemampuan sains siswa Deli Serdang lebih baik dibandingkan dengan kemampuan matematika dan kemampuan membaca. Data di atas dapat disajikan dalam bentuk diagram sebagai berikut: Indonesia National Assessment Programme (INAP) 88

89 Gambar 4.6 Benchmark Kemampuan Sains Siswa Deli Serdang C. Karakter butir soal INAP nasional dibandingkan dengan soal internasional 1. Karakter Butir Soal INAP Matematika Untuk dapat membayangkan bagaimanakah yang dimaksud dengan bernalar matematika bagi siswa kelas 5 SD berikut disajikan hasil analisis butir-butir soal INAP baik yang merupakan hasil penulisan di tingkat nasional maupun soal-soal dari studi internasional. kode_soal Konten level par-a par-b par-c M1_01 Pecahan dgn gambar piktorial K M1_02 Nilai angka/nilai tempat suatu bilangan K M1_03 Urutan kelipatan bilangan K M1_04 Operasi hitung pecahan K M1_05 Nama dan jenis sudut K M1_06 Identifikasi bentuk bangun datar K M1_07 Volume dengan kubus satuan (satuan tdk baku) K Indonesia National Assessment Programme (INAP) 89

90 kode_soal Konten level par-a par-b par-c M1_08 Pencerminan bangun datar K M1_09 Keliling Persegi K M1_10 Mengidentifikasi bangun datar K M2_01 urutan bilangan (deret hitung) K M2_02 Urutan bilangan Bulat K-! M2_03 Perhitungan waktu :jam, menit dan detik K M2_04 Operasi hitung satuan panjang K M2_05 Operasi hitung satuan kuantitas K M2_06 Besar sudut jam K M2_07 Pencerminan bangun datar K M2_08 Kelipatan bilangan K M2_09 Pengukuran kuantitas K M2_10 Pemecahan masalah yang berkaitan dgn KPK K M2_11 Ukuran waktu (jama, menit dan detik) K M2_12 Keliling Jajar genjang K M2_13 Luas jajar genjang K M2_14 melengkapi urutan bialangan deret hitung K M2_15 Pencerminan benda K M3_01 Pembulatan bilangan K M3_02 Penjumlahan bilangan bulat dengan garis bilangan K M3_03 FPB tiga bilangan dua angka K M3_04 Keliling bangun datar persegi panjang K M3_05 Luas bangun segitiga K M3_06 Membandingkan dua pecahan biasa K M3_07 Faktor persektuan dua bilangan K M3_08 Sumbu simetri bangun datar K M3_09 Pengunkuran kuantitas dalam soal cerita K M3_10 Operasi hitung campuran bilangan bulat K M3_11 Operasi hitung pengurangan pecahan biasa K M3_12 Pemecahan masalah dalam FPB K M3_13 Pengurangan pecahan dalam pemecahan masalah K M3_14 Pengukuran panjang dalam pemecahan masalah K M4_01 Penjumlahan bilangan cacah dua bilangan dua-tiga angka K M4_02 Urutan pola bilangan K M4_03 Perbandingan dalam pecahan K M4_04 Pola dan kelipatan bilangan K M4_05 mencari salah satu suku dalam Pengurangan K M4_06 Pola hitungan K M4_07 Ukuran berat K M4_08 Ukuran Luas dgn satuan baku K M4_09 Aplikasi Pembagian dalam pemecahan masalah K Indonesia National Assessment Programme (INAP) 90

91 kode_soal Konten level par-a par-b par-c M4_10 Besar sudut K M4_11 Urutan Pola bentuk K M5_01 Mengurutan beberapa pecahan K M5_02 Operasi hitung campuran bilangan cacah K M5_03 Mengubah satuan waktu (jam, menit dan detik) K M5_04 Mengenal pecahan dengan gambar Piktorial K M5_05 Uang dan belanja dalam soal cerita K M5_06 Simetri lipat bangun datar K M5_07 Luas gabungan dua buah bangun datar K M5_08 Mata Uang dan belanja dalam soal cerita K M5_09 Urutan pecahan dalam soal cerita K M5_10 Nilai pecahan dengan bidang Piktorial K M5_11 Ukuran satuan kuantitas dalam soal cerita K M5_12 Menentukan salah satu unsur bangun ruang (Balok) K M5_13 Pengukuran waktu dalam soal cerita K M5_14 Jaring-jaring bangun ruang K M6_01 Kelipatan Persekutuan dua bilangan K M6_02 Nama lain pecahan biasa K M6_03 Unsur bangun ruang (sisi, sudut dan rusuk) K M6_04 Sifat-sifat bangun ruang K M6_05 Penjumlahan pecahan campuran K M6_06 Ukuran satuan waktu (windu, tahun, abad) K M6_07 Ukuran satuan panjang dalam soal cerita K M6_08 Operasi hitung bilangan bulat dalam pemecahan masalah K M6_09 Faktor persekutuan dua bilangan dua angka K M6_10 Penjumlahan pecahan biasa dgn pecahan campuran K M6_11 Unsur bangun ruang tabung K M6_12 Jaring-jaring kubus K M6_13 Pengurangan pecahan dalam soal cerita K M6_14 Uang dan belanja dalam soal cerita K M7_01 Pengurangan pecahan 3 buah biasa K M7_02 Penjumlahan ukuran berat dgn satuan berbeda K M7_03 FPB dalam pemecahan masalah K M7_04 Pencerminan bangun datar K M7_05 KPK dalam pemecahan masalah K M7_06 Penjumlahan satuan ukuran panajang yang berbeda K M7_07 Bangun simetris K M7_08 Penjumlahan satuan ukuran waktu dalam soal cerita K M7_09 Kpk dari dua bilangan dua angka K M7_10 Urutan bilangan 4 angka K M7_11 Pola operasi hitung bilangan cacah K Indonesia National Assessment Programme (INAP) 91

92 kode_soal Konten level par-a par-b par-c M7_12 Jaring-jaring kubus K M7_13 Pencerminan bidang datar K M7_14 Bangun datar tidak simetris K M8_01 Urutan bilangan 4 buah bilangan 4 angka K M8_02 Urutan bilangan bulat 6 buah bilangan satu angka K M8_03 Perkalian dan pembagian bilangan K M8_04 Opearsi hitung ukuran waktu yang berbeda K M8_05 Menjumlahkan satun ukuran waktu (jam, menit,daetik) K M8_06 Pengukuran sudut dengan sudut satuan baku K M8_07 Pencderminan bangun datar K M8_08 Keliling bangun datar jajargenjang K M8_09 Operasi hitung campuran bilangan cacah K M8_10 Menyederhanakan bentuk pecahan biasa K M8_11 Penjumlahan Ukuran kuantitas dengan satuan berbeda K M8_12 Simetri lipat bangun datar K M8_13 Sumbu simetri dalam pemecahan masalah K Soal-soal INAP dianalisis berdasarkan item response theory dengan menggunakan dua model: tiga parameter logistik model untuk soal-soal bentuk pilihan ganda dan model generalized partial credit model untuk soal-soal isian dan uraian. Hasil analisis butir menunjukkan bahwa sebagian besar soal tersebut memiliki daya beda yang baik (> 0.5) yang kurang dari 0,5 dari total 103 soal hanya 19 soal dan semua soal tersebar pada rentang tingkat kesukaran yang memadai (antara -2 sampai +2). Sedangkan estimasi parameter pseudo guessing atau parameter c menunjukkan bahwa 10 semua butir termasuk dalam kategori < 0 atau.0.5 dan yang lainnya terletak antara 0,00-0,50. Soal-soal pada cluster M1 dan M4 adalah soal-soal dari survey internasional. Terlihat pada hasil analisis, item parameter butir soal INAP sebanding dengan item parameter butir soal internasional, padahal soal INAP sifatnya lebih curriculum matched dibandingkan soal-soal internasional. Artinya survey INAP memang menggunakan alat ukur yang dapat dipertanggungjawabkan kualitasnya. Indonesia National Assessment Programme (INAP) 92

93 2. Karakter Butir Soal INAP Membaca Berikut disajikan hasil analisis butir-butir soal INAP membaca baik yang merupakan hasil penulisan di tingkat nasional maupun soal-soal dari studi internasional. Kode Soal Topik par-a par-b par-c R7_01 urutan cerita 1, , R7_02 peristiwa 0, , R7_03 harapan 1, , R7_04 menarik kesimpulan 1, , ,28298 R7_05 peristiwa 0, , ,26297 R7_06 memprediksi 0, , R7_07 ungkapan perasaan 0, , ,24045 R7_08 ungkapan perasaan 0, , ,41691 R7_09 kalimat petunjuk 1, ,5374 0,14265 R7_10 gambaran perasaan 0, , R7_11 tokoh cerita 0, , ,60141 R7_12 mengambil kesimpulan 1, ,0843 0,19689 R7_13 penyampaian pesan 0, , ,17162 R1_01 isi bacaan 0, , ,27554 R1_02 identitas tokoh 1, , R1_03 identitas tokoh 1, , R1_04 kalimat harapan 0, , ,16808 R1_05 watak tokoh 1, , ,20268 R1_06 membuat ringkasan 0,6852 0, ,16785 R1_07 kalimat harapan 0, , R1_08 penggunaan alat 1, , Indonesia National Assessment Programme (INAP) 93

94 Kode Soal Topik par-a par-b par-c R1_09 menyampaikan pendapat 0, , ,92391 R1_10 isi pengumuman 0, , ,1466 R1_11 memprediksi sesuatu 0, , R1_12 peristiwa 0,6607-0,11 0 R1_13 tokoh dalam bacaan 1, , R1_14 peristiwa 1, , R2_01 mengidentitas tokoh 0,9013-1, R2_02 penjelasan manfaat 0, , R2_03 menunjukkan tempat 1,3233 0, R2_04 menjelaskan cara 1, , ,20561 R2_05 menjelaskan cara 0, , ,18603 R2_06 menjelaskan tujuan 0, , R2_07 memberi alasan 0, , R2_08 peristiwa 0, , R2_09 menentukan kalimat 0, , R2_10 menjelaskan pengalaman 0, , R2_11 identitas tokoh 1, , R2_12 membuat kesimpulan 0, , ,17571 R2_13 peristiwa 0, , R8_01 menemukan tempat 1, , R8_02 menjelaskan keadaan 0, , ,1475 R8_03 menunjukkan letak 1, , R8_04 memberi alasan 0, , ,80061 R8_05 menjelaskan peristiwa 0, , ,16824 R8_06 identitas tokoh 0,7288-0, Indonesia National Assessment Programme (INAP) 94

95 Kode Soal Topik par-a par-b par-c R8_07 menjelaskan cara 0, , ,24538 R8_08 mengambil tindakan 0, , ,66671 R8_09 mengambil tindakan 0, , ,79637 R8_10 menunjukkan tempat 0,9588 1, ,13007 R8_11 menjelaskan isi bacaan 0, , R3_01 mengambil kesimpulan 0, , R3_02 menjelaskan cara 0, , ,17145 R3_03 mengingat waktu 0, , R3_04 menjelaskan cara 0, ,734 0,28954 R3_05 mengingat waktu 1,0855-0, ,18539 R3_06 member informasi 1, , R3_07 menjelaskan cara 0, , ,21325 R3_08 sajak pada pantun 0, , R3_09 larik pada pantun 0, , ,21681 R3_10 kata bersajak 0, , ,95876 R3_11 isi pantun 0, , R3_12 larik pada pantun 0, , R3_13 suku kata pada pantun 0,7525 2, R4_01 menjelaskan informasi 0, , R4_02 menjelaskan cara 0,7596 0, ,17624 R4_03 menjelaskan waktu 0, , R4_04 identitas tokoh 0, , ,24362 R4_05 menjelaskan cara 2, , R4_06 menjelaskan cara 0, , ,02821 Indonesia National Assessment Programme (INAP) 95

96 Kode Soal Topik par-a par-b par-c R4_07 menjelakan letak 1, , R4_08 menarik kesimpulan 1, , ,24938 R4_09 waktu 1,052-0, R4_10 menarik kesimpulan 0, , ,24727 R4_11 menentukan asal 0, , ,70488 R4_12 mengambil tindakan 1, , R4_13 isi pantun 0, , R4_14 isi pantun 0, , ,16298 R5_01 mengklasifikasi 1, , ,1965 R5_02 menjelaskan alasan 1, , R5_03 inti cerita 0, , ,22534 R5_04 menjelaskan maksud 1, , ,23428 R5_05 informasi waktu 1, , R5_06 tokohcerita 0,6186 1, ,97723 R5_07 mengemukakan pendapat 0, , ,01999 R5_08 sikap tokoh cerita 1, , ,244 R5_09 memprediksi 1, , R5_10 tokoh cerita 0, , R5_11 mengidentitas tempat 1, , ,19976 R5_12 menjelaskan sebab 0,9725-0, ,19329 R6_01 menjelaskan manfaat 0, , R6_02 menentukan jarak 0, , R6_03 mengklasifikasi sesuatu 0, , ,86807 R6_04 melakukan tindakan 0, , Indonesia National Assessment Programme (INAP) 96

97 Kode Soal Topik par-a par-b par-c 0,77389 R6_05 menunjukkan tempat 1, ,224 0 R6_06 menjelaskan keadaan 0, , R6_07 kalimat utama 0, , R6_08 penyampaian pesan 1, , ,20429 R6_09 Memprediksi 0, , R6_10 mengambil kesimpulan 0, , ,1181 R6_11 melakukan tindakan 0, , ,16513 R6_12 Peristiwa 0, , R6_13 penjelasan strategi 1, , ,34808 Hasil analisis butir menunjukkan bahwa sebagian besar soal tersebut memiliki daya beda yang baik (> 0.5) yang kurang dari 0.5 (< 0.5 ) hanya 2 soal saja dan semua soal tersebar pada rentang tingkat kesukaran yang memadai (antara -2 sampai +2). Sedangkan estimasi parameter pseudo guessing atau parameter c menunjukkan bahwa 14 semua butir termasuk dalam kategori < 0 atau.0.5 dan yang lainnya terletak antara 0,00-0,50. Terlihat pada hasil analisis, item parameter butir soal INAP untuk membaca sebanding dengan item parameter butir soal internasional, padahal soal INAP sifatnya lebih curriculum matched dibandingkan soal-soal internasional. Artinya survey INAP memang menggunakan alat ukur yang dapat dipertanggungjawabkan kualitasnya. Indonesia National Assessment Programme (INAP) 97

98 3. Karakter Butir Soal INAP Sains Berikut disajikan hasil analisis butir-butir soal INAP membaca baik yang merupakan hasil penulisan di tingkat nasional maupun soal-soal dari studi internasional. kode_soal konten level par-a par-b par-c S7_01 perubahan wujud benda K1 0, , ,23788 S7_02 kesehatan panca indra K1 0,9869-1, ,27554 S7_03 kenampakan bumi K2 0, , S7_04 rangka manusia K1 0, ,249 0,32492 S7_05 hidung K1 0, , ,22709 S7_06 struktur akar dan fungsinya K1 0, , ,14394 S7_07 cahaya dan sifatnya K1 1, , ,37964 S7_08 cahaya dan penglihatan K1 1, , ,20322 S7_09 daur hidup K1 0, , ,2656 S7_10 struktur bumi K1 0,6339-0, ,25923 S1_01 gaya K1 0, ,0812 0,26493 S1_02 kesehatan panca indra K1 0, , ,224 S1_03 daur hidup K1 1, , ,15745 S1_04 dampak pengambilan bahan alam K1 1, ,3376 0,19835 S1_05 rangka manusia K1 0, , ,19934 S1_06 struktur daun K2 1, , S1_07 perubahan sifat benda K3 0, ,7884 1,03838 S1_08 ekosistem K3 0, , S1_09 struktur bunga dan fungsinya K1 1,3775 1, ,1634 S1_10 daur hidup K3 0, , S1_11 wujud benda dan sifatnya K1 1, , ,16902 S1_12 energi bunyi dan alat musik K1 2, , ,1105 S2_01 kerusakan lingkungan K1 0, , ,19576 S2_02 wujud benda dan sifatnya K2 1, , S2_03 simbiosis dan rantai makanan K1 0, , ,339 Indonesia National Assessment Programme (INAP) 98

99 kode_soal konten level par-a par-b par-c S2_04 gaya K2 0, , S2_05 kerusakan lingkungan K1 0, , S2_06 simbiosis dan rantai makanan K2 0, , S2_07 posisi bulan K1 0, ,29825 S2_08 wujud benda dan sifatnya K1 1,2718 0, ,27117 S2_09 panca indra dan fungsinya K3 0, , ,06796 S2_10 panas K1 0, , ,19922 S2_11 sumber daya alam dan teknologi K2 0, , S2_12 hewan peliharaan K1 0, , ,20524 S8_01 wujud benda dan sifatnya K1 0, , ,197 S8_02 panas K1 0, , ,35282 S8_03 pemeliharaan kesehatan kerangka K1 1, , ,20702 tubuh S8_04 ekosistem K2 0, , S8_05 gaya K1 0, , ,152 S8_06 simbiosis dan rantai makanan K1 0, , ,29224 S8_07 sumber daya alam dan teknologi K1 1, , ,24227 S8_08 ekosistem K1 0, , ,14006 S8_09 sumber daya alam K1 0, , ,283 S8_10 sumber daya alam K1 1,0765 0,2129 0,24 S8_11 rangka manusia dan fungsinya K1 0, , ,29287 S3_01 energi bunyi dan alat musik K2 0,8211 1, S3_02 wujud benda dan sifatnya K3 0, , ,62081 S3_03 mata K1 1, ,1873 0,10262 S3_04 perubahan wujud benda K1 0, ,29399 S3_05 struktur bunga dan fungsinya K1 1, , ,22022 S3_06 daur hidup K1 0, , ,18415 S3_07 energi alternatif K1 0,523-0, ,20748 Indonesia National Assessment Programme (INAP) 99

100 kode_soal konten level par-a par-b par-c S3_08 perubahan wujud benda K1 0, , ,20215 S3_09 sumber daya alam dan teknologi K3 1, , S3_10 perubahan wujud benda K2 0,8996 1, S3_11 rangka manusia dan fungsinya K2 0,9212 1, S3_12 ekosistem K3 0, , ,00575 S4_01 sumber daya alam K3 0,4436-1, ,24223 S4_02 energi alternatif K1 1, , ,14961 S4_03 energi bunyi dan alat musik K1 0, , ,24977 S4_04 posisi bulan K1 1, , ,22412 S4_05 gaya K2 1, , S4_06 energi alternatif K1 0,7685-0, ,19163 S4_07 struktur batang dan fungsinya K1 0, , ,22032 S4_08 simbiosis dan rantai makanan K3 0, , ,24864 S4_09 gaya K2 1, , S4_10 penggolongan hewan berdasarkan K3 0,3937-2,3883 0,1606 jenis makanannya S4_11 perubahan lingkungan fisik terhadap K2 1, , daratan S5_01 sumber daya alam K1 1,0783 0, ,2146 S5_02 pemeliharaan kesehatan kerangka K1 0, , ,18413 tubuh S5_03 energi gerak K1 0, , ,14824 S5_04 sifat bahan dan kegunaannya K3 0, , ,82349 S5_05 daur hidup K3 0, , ,74105 S5_06 rangka manusia dan fungsinya K1 0, , ,2011 S5_07 struktur daun dan fungsinya K1 0, , ,27961 S5_08 sifat bahan dan kegunaannya K1 1, ,3306 0,13249 S5_09 perubahan lingkungan fisik terhadap daratan K1 0, , ,21171 Indonesia National Assessment Programme (INAP) 100

101 kode_soal konten level par-a par-b par-c S5_10 kepedulian terhadap hewan K3 0, , peliharaan S5_11 energi alternatif K2 0, , S5_12 sumber daya alam K3 0, , S6-01 struktur bunga dan fungsinya K1 1, , ,27865 S6-02 energi bunyi dan alat musik K1 1, ,3398 0,20193 S6-03 struktur akar dan fungsinya K1 1, , ,27558 S6-04 kepedulian terhadap hewan K1 1,4621-1, ,20257 peliharaan S6-05 penggolongan hewan berdasarkan K2 0, , jenis makanannya S6-06 struktur akar dan fungsinya K3 1, , ,36727 S6-07 wujud benda dan sifatnya K1 0, ,6229 0,21965 S6-08 gaya K3 0, , ,56919 S6-09 gaya K1 1,0112-0, ,20191 S6-10 mata K3 0, ,6641 1,48718 S6-11 kepedulian terhadap hewan K1 0, , ,17681 peliharaan S6-12 daur hidup K1 0, , ,17947 Hasil analisis butir menunjukkan bahwa sebagian besar soal tersebut memiliki daya beda yang baik (> 0.5) yang kurang dari 0.5 (< 0.5 ) hanya 4 soal saja dan hampir semua soal tersebar pada rentang tingkat kesukaran yang memadai (antara -2 sampai +2) hanya 5 soal yan terletak pada rentan < -2 atau > 2. Sedangkan estimasi parameter pseudo guessing atau parameter c menunjukkan bahwa 10 semua butir termasuk dalam kategori < 0 atau.0.5 dan yang lainnya terletak antara 0,00-0,50. Terlihat pada hasil analisis, item parameter butir soal INAP untuk sains sebanding dengan item parameter butir soal internasional, padahal soal INAP sifatnya lebih curriculum matched dibandingkan soal-soal internasional. Artinya survey INAP memang menggunakan alat ukur yang dapat dipertanggungjawabkan kualitasnya. Indonesia National Assessment Programme (INAP) 101

102 D. Rerata Berdasarkan Level Soal Soal-soal INAP disajikan atas beberapa level dengan demikian soal-soal tersebut dapat mengukur kemampuan siswa dari level yang terendah sampai level yang tertinggi. 1. Rerata Soal Matematika Berdasarkan Level Soal Soal-soal matematika dipetakan menjadi tiga level berdasarkan psikologi kognitif: knowing, applying, dan reasoning. Secara umum asumsi kemampuan kognitif terendah adalah knowing. Siswa pada level knowing sekedar mengetahui prosedur dan fakta yang terkait dengan matematika. Siswa pada level applying lebih mampu dibandingkan pada level knowing karena siswa tidak sekedar mengetahui prosedur dan fakta matematika namun mampu mengaplikasikannya pada konteks yang lain. Sedangkan level reasoning dianggap sebagai level kognitif yang tertinggi diantara level yang lain karena siswa telah mampu bernalar dengan kemampuan matematika yang dimilikinya. Siswa mampu mengaitkan permasalahan dalam konteks yang tidak familiar dengan konsep matematika yang diketahuinya Dibawah ini disajikan pemetaan soal berdasarkan level Kode Soal Konten Level M6_11 Penjumlahan Ukuran kuantitas dengan satuan berbeda K- 1 M1_02 Urutan bilangan Bulat K-1 M7_02 Nilai angka/nilai tempat suatu bilangan K-1 M7_03 Urutan kelipatan bilangan K-1 M1_01 urutan bilangan (deret hitung) K-1 M1_14 melengkapi urutan bialangan deret hitung K-1 M8_09 Aplikasi Pembagian dalam pemecahan masalah K-1 M5_10 Urutan bilangan 4 angka K-1 M6_01 Urutan bilangan 4 buah bilangan 4 angka K-1 M6_02 Urutan bilangan bulat 6 buah bilangan satu angka K-1 M6_03 Perkalian dan pembagian bilangan K-1 M1_08 Kelipatan bilangan K-1 Indonesia National Assessment Programme (INAP) 102

103 Kode Soal Konten Level M2_03 FPB tiga bilangan dua angka K-1 M2_07 Faktor persektuan dua bilangan K-1 M8_04 Pola dan kelipatan bilangan K-1 M4_01 Kelipatan Persekutuan dua bilangan K-1 M4_09 Faktor persekutuan dua bilangan dua angka K-1 M5_09 Kpk dari dua bilangan dua angka K-1 M7_05 Nama dan jenis sudut K-1 M7_06 Identifikasi bentuk bangun datar K-1 M1_06 Besar sudut jam K-1 M1_11 Ukuran waktu (jama, menit dan detik) K-1 M8_07 Ukuran berat K-1 M8_10 Besar sudut K-1 M3_03 Mengubah satuan waktu (jam, menit dan detik) K-1 M4_06 Ukuran satuan waktu (windu, tahun, abad) K-1 M6_04 Opearsi hitung ukuran waktu yang berbeda K-1 M6_06 Pengukuran sudut dengan sudut satuan baku K-1 M7_08 Pencerminan bangun datar K-1 M7_10 Mengidentifikasi bangun datar K-1 M2_08 Sumbu simetri bangun datar K-1 M3_06 Simetri lipat bangun datar K-1 M5_04 Pencerminan bangun datar K-1 M5_07 Bangun simetris K-1 M5_13 Pencerminan bidang datar K-1 M6_07 Pencderminan bangun datar K-1 M6_08 Keliling bangun datar jajargenjang K-1 M6_12 Simetri lipat bangun datar K-1 M2_01 Pembulatan bilangan K-1 M2_02 Penjumlahan bilangan bulat dengan garis bilangan K-1 M2_10 Operasi hitung campuran bilangan bulat K-1 M8_01 Penjumlahan bilangan cacah dua bilangan dua-tiga K-1 angka M2_06 Membandingkan dua pecahan biasa K-1 Indonesia National Assessment Programme (INAP) 103

104 Kode Soal Konten Level M2_11 Operasi hitung pengurangan pecahan biasa K-1 M3_01 Mengurutan beberapa pecahan K-1 M3_04 Mengenal pecahan dengan gambar Piktorial K-1 M3_09 Urutan pecahan dalam soal cerita K-1 M3_10 Nilai pecahan dengan bidang Piktorial K-1 M4_02 Nama lain pecahan biasa K-1 M4_05 Penjumlahan pecahan campuran K-1 M4_10 Penjumlahan pecahan biasa dgn pecahan campuran K-1 M4_13 Pengurangan pecahan dalam soal cerita K-1 M5_01 Pengurangan pecahan 3 buah biasa K-1 M6_10 Menyederhanakan bentuk pecahan biasa K-1 M7_07 Volume dengan kubus satuan (satuan tdk baku) K-1 M3_12 Menentukan salah satu unsur bangun ruang (Balok) K-1 M3_14 Jaring-jaring bangun ruang K-1 M4_03 Unsur bangun ruang (sisi, sudut dan rusuk) K-1 M4_11 Unsur bangun ruang tabung K-1 M5_12 Jaring-jaring kubus K-1 M8_02 Urutan pola bilangan K-2 M3_05 Uang dan belanja dalam soal cerita K-2 M3_08 Mata Uang dan belanja dalam soal cerita K-2 M4_14 Uang dan belanja dalam soal cerita K-2 M2_12 Pemecahan masalah dalam FPB K-2 M5_03 FPB dalam pemecahan masalah K-2 M5_05 KPK dalam pemecahan masalah K-2 M1_03 Perhitungan waktu :jam, menit dan detik K-2 M1_04 Operasi hitung satuan panjang K-2 M1_05 Operasi hitung satuan kuantitas K-2 M1_09 Pengukuran kuantitas K-2 M2_09 Pengunkuran kuantitas dalam soal cerita K-2 M3_11 Ukuran satuan kuantitas dalam soal cerita K-2 M3_13 Pengukuran waktu dalam soal cerita K-2 Indonesia National Assessment Programme (INAP) 104

105 Kode Soal Konten Level M4_07 Ukuran satuan panjang dalam soal cerita K-2 M5_02 Penjumlahan ukuran berat dgn satuan berbeda K-2 M5_06 Penjumlahan satuan ukuran panajang yang berbeda K-2 M5_08 Penjumlahan satuan ukuran waktu dalam soal cerita K-2 M6_05 Menjumlahkan satun ukuran waktu (jam, menit K-2,daetik) M7_09 Keliling Persegi K-2 M1_07 Pencerminan bangun datar K-2 M1_12 Keliling Jajar genjang K-2 M1_13 Luas jajar genjang K-2 M2_04 Keliling bangun datar persegi panjang K-2 M2_05 Luas bangun segitiga K-2 M8_08 Ukuran Luas dgn satuan baku K-2 M8_11 Urutan Pola bentuk K-2 M3_07 Luas gabungan dua buah bangun datar K-2 M8_05 mencari salah satu suku dalam Pengurangan K-2 M3_02 Operasi hitung campuran bilangan cacah K-2 M4_08 Operasi hitung bilangan bulat dalam pemecahan masalah M6_09 Operasi hitung campuran bilangan cacah K-2 M7_01 Pecahan dgn gambar piktorial K-2 M7_04 Operasi hitung pecahan K-2 M2_13 Pengurangan pecahan dalam pemecahan masalah K-2 M1_15 Pencerminan benda K-2 M4_04 Sifat-sifat bangun ruang K-2 M4_12 Jaring-jaring kubus K-2 M1_10 Pemecahan masalah yang berkaitan dgn KPK K-3 M8_06 Pola hitungan K-3 M6_13 Sumbu simetri dalam pemecahan masalah K-3 M5_11 Pola operasi hitung bilangan cacah K-3 M2_14 Pengukuran panjang dalam pemecahan masalah K-3 M8_03 Perbandingan dalam pecahan K-3 K-2 Indonesia National Assessment Programme (INAP) 105

106 Level K-1 berarti soal pada kompetensi dasar tersebut berada pada level knowing. Level K-2 berarti soal pada kompetensi dasar tersebut berada pada level applying. Level K-3 berarti soal pada kompetensi dasar tersebut berada pada level reasoning. Dari tabel di atas pada soal matematika terlihat bawa untuk level K-1 ( knowing) ada 60 soal atau 58%, untuk level K-2 (applying) ada 38 soal atau 36% sedangkan level tertinggi yaitu K-3 (reasoning) terdapat 6 soal atau 6%. Sebaran persentase soal berdasarkan level kognitif tersaji pada grafik berikut: Sebaran Persentase Soal Berdasarkan Level Kognitif 6% 36% 58% Knowing Applying Reasoning Dari sebaran soal berdasarkan level kognitif tersebut dapat dipetakan berdasarkan tingkat kesukaran. Adapun rerata tingkat kesukaran soal berdasarkan level kognitif adalah sebagai berikut: Indonesia National Assessment Programme (INAP) 106

107 Tingkat Kesukaran Soal Berdasarkan Level Kognitif Jumlah Soal Tingkat Kesukaran 0 Knowing Applying Reasoni ng Jumlah Soal Tingkat Kesukaran 0,425 0,653 1,263 Rata- rata tingkat kesukarasn soal berdasarkan level kognitif seperti tertera pada diagram di atas adalah sebagi berikut: untuk soal yang termasuk level kognitif rata-rata tingkat kesukaran soalnya adalah 0,425; level applying rata-rata tingkat kesukaran adalah 0,653; level tertinggi yaitu level reasoning rata-rata tingkat kesukaran soal adalah 1,263. Selanjutnya dari 104 soal matematika yang ada dapat dipetakan ke dalam beberapa topik/standar Kompetensi yaitu : a. Operasi hitung bilangan b. Faktor dan Kelipatan c. Sudut, Panjang dan Berat d. Bangun Datar e. Bilangan Bulat f. Pecahan g. Sifat Bangun Ruang Pemetaan berdasarkan tingkat kesukaran topik/standar Kompetensi disajikan pada tabel berikut : Indonesia National Assessment Programme (INAP) 107

108 Topik Rata-rata tingkat kesukaran Jumlah Soal Operasi hitungan bilangan 0, Faktor dan kelipatan 1, Sudut, panjang, dan berat 0, Bangun datar 0, Bilangan bulat 0,31 10 Pecahan 0, Sifat bangun ruang 0, Rerata Tingkat Kesukaran Soal Berdasarkan Topik 5 0 Rata-rata tingkat kesukaran Jumlah Soal Dari data di atas dapat kita urutkan rerata tingkat kesukaran soal dari yang terendah sampai yang tersulit berdasarkan topiknya adalah sebagai berikut: operasi hitung bilangan rata-rata tingkat kesukaran soal adalah 0,286; bilangan bulat 0,31; pecahan 0,398; bangun datar 0,439; sifat bangun ruang 0,831; sudut, panjang dan berat 0,629: Faktor dan kelipatan 1,134 Indonesia National Assessment Programme (INAP) 108

109 2. Rerata Soal Membaca Berdasarkan Level Soal Soal-soal membaca dipetakan menjadi empat level berdasarkan psikologi kognitif yaitu: permormative, functional, informational, epistemic. Adapun pemetaan soalnya disajikan pada tabel berikut Kode Soal Topik Level R7_05 peristiwa K_1 R1_02 identitas tokoh K_1 R1_03 identitas tokoh K_1 R1_13 tokoh dalam bacaan K_1 R1_14 peristiwa K_1 R2_01 mengidentitas tokoh K_1 R2_03 menunjukkan tempat K_1 R2_09 menentukan kalimat K_1 R8_01 menemukan tempat K_1 R8_03 menunjukkan letak K_1 R8_07 menjelaskan cara K_1 R8_08 mengambil tindakan K_1 R3_03 mengingat waktu K_1 R3_04 menjelaskan cara K_1 R3_05 mengingat waktu K_1 R3_08 sajak pada pantun K_1 R3_09 larik pada pantun K_1 R3_10 kata bersajak K_1 R3_12 larik pada pantun K_1 R3_13 suku kata pada pantun K_1 R4_03 menjelaskan waktu K_1 R4_04 identitas tokoh K_1 R4_09 waktu K_1 R4_13 isi pantun K_1 R5_01 mengklasifikasi K_1 R5_04 menjelaskan maksud K_1 R5_10 tokoh cerita K_1 Indonesia National Assessment Programme (INAP) 109

110 Kode Soal Topik Level R6_03 mengklasifikasi K_1 sesuatu R6_12 peristiwa K_1 R7_02 peristiwa K_2 R7_04 menarik kesimpulan K_2 R7_13 penyampaian pesan K_2 R1_08 penggunaan alat K_2 R2_02 penjelasan manfaat K_2 R8_06 identitas tokoh K_2 R4_02 menjelaskan cara K_2 R7_03 harapan K_3 R7_09 kalimat petunjuk K_3 R7_11 tokoh cerita K_3 R1_01 isi bacaan K_3 R1_05 watak tokoh K_3 R1_07 kalimat harapan K_3 R1_10 isi pengumuman K_3 R1_11 memprediksi sesuatu K_3 R1_12 peristiwa K_3 R2_04 menjelaskan cara K_3 R2_05 menjelaskan cara K_3 R2_08 peristiwa K_3 R2_11 identitas tokoh K_3 R2_13 peristiwa K_3 R8_02 menjelaskan keadaan K_3 R8_05 menjelaskan peristiwa K_3 R8_10 menunjukkan tempat K_3 R3_01 mengambil kesimpulan K_3 R3_02 menjelaskan cara K_3 R3_06 member informasi K_3 R3_07 menjelaskan cara K_3 R3_11 isi pantun K_3 Indonesia National Assessment Programme (INAP) 110

111 Kode Soal Topik Level R4_01 menjelaskan informasi K_3 R4_05 menjelaskan cara K_3 R4_06 menjelaskan cara K_3 R4_07 menjelakan letak K_3 R4_11 menentukan asal K_3 R4_12 mengambil tindakan K_3 R5_02 menjelaskan alasan K_3 R5_05 informasi waktu K_3 R5_09 memprediksi K_3 R5_11 mengidentitas tempat K_3 R5_12 menjelaskan sebab K_3 R6_01 menjelaskan manfaat K_3 R6_02 menentukan jarak K_3 R6_05 menunjukkan tempat K_3 R6_11 melakukan tindakan K_3 R6_13 penjelasan strategi K_3 R7_01 urutan cerita K_4 R7_06 memprediksi K_4 R7_07 ungkapan perasaan K_4 R7_08 ungkapan perasaan K_4 R7_10 gambaran perasaan K_4 R7_12 mengambil kesimpulan K_4 R1_04 kalimat harapan K_4 R1_06 membuat ringkasan K_4 R1_09 menyampaikan K_4 pendapat R2_06 menjelaskan tujuan K_4 R2_07 memberi alasan K_4 R2_10 menjelaskan K_4 pengalaman R2_12 membuat kesimpulan K_4 R8_04 memberi alasan K_4 Indonesia National Assessment Programme (INAP) 111

112 Kode Soal Topik Level R8_09 mengambil tindakan K_4 R8_11 menjelaskan isi bacaan K_4 R4_08 menarik kesimpulan K_4 R4_10 menarik kesimpulan K_4 R4_14 isi pantun K_4 R5_03 inti cerita K_4 R5_06 tokohcerita K_4 R5_07 mengemukakan K_4 pendapat R5_08 sikap tokoh cerita K_4 R6_04 melakukan tindakan K_4 R6_06 menjelaskan keadaan K_4 R6_07 kalimat utama K_4 R6_08 penyampaian pesan K_4 R6_09 memprediksi K_4 R6_10 mengambil kesimpulan K_4 Level K-1 berarti soal pada kompetensi dasar tersebut berada pada level permormative. Level K-2 berarti soal pada kompetensi dasar tersebut berada pada level functional. Level K-3 berarti soal pada kompetensi dasar tersebut berada pada level informational. Level K-4 berarti soal pada kompetensi dasar tersebut berada pada level epistemic Dari tabel di atas pada soal membaca terlihat bawa untuk level K-1 ada 29 soal, untuk level K-2 ada 7 soal, level K-3 ada 38 soal dan level K-4 ada 29 soal Sebaran persentase soal berdasarkan level kognitif tersaji pada grafik berikut: Indonesia National Assessment Programme (INAP) 112

113 Jumlah Soal 28% 28% 7% 37% Performative Functional Informational epistemic Dari sebaran soal berdasarkan level kognitif tersebut dapat dipetakan berdasarkan tingkat kesukaran. Adapun rerata tingkat kesukaran soal berdasarkan level kognitif adalah sebagai berikut: Tingkat Kesukaran Soal Berdasarkan Level Kognitif Performative Functional Informationa epistemic l Jumlah Soal Tingkat Kesukaran 0,263 0,326 0,117 0,599 Dari diagram di atas terlihat bahawa tingkat kesukaran soal untuk level performative adalah 0,263; tingkat kesukaran soal untk level functional adalah 0,326; tingkat kesukaran soal untuk level informational adalah 0,117 dan tingkat kesukaran soal untuk level epistemic adalah 0,599. Indonesia National Assessment Programme (INAP) 113

114 Pemetaan berdasarkan tingkat kesukaran topik/standar Kompetensi disajikan pada tabel berikut : Topik Rata-Rata Tingkat Kesukaran Jumlah Soal gambaran perasaan/harapan 0,838 5 identitas tokoh 1, informasi waktu, tempat, cerita dan bacaan 0, pantun dan sajak 0,740 8 Kalimat 0,772 6 membuat kesimpulan 0, Peristiwa 0,767 7 menjelaskan cara 0, melakukan tindakan 0, Rerata Tingkat Kesukaran Soal Berdasarkan Topik 25,000 20,000 15,000 10,000 5,000 0,000 Dari data di atas dapat kita urutkan rerata tingkat kesukaran soal dari yang terendah sampai yang tersulit berdasarkan topiknya adalah sebagai berikut:pantun dan sajak tingkat kesukaran 0,740 sebanyak 8 soal ; kalimat dengan tingkat kesukaran 0,772 sebanyak 6 soal; peristiwa dengan tingkat kesukaran 0,767 sebanyak 7 soal; gambaran perasaan dan harapan dengan tingkat kesukaran soal Indonesia National Assessment Programme (INAP) 114

115 0,838 dengan jumlah soal 5; melakukan tindakan dengan tingkat kesukaran 0,865 dengan jumlah soal 10; membuat kesimpulan dengan tingkat kesukaran 0,911 dan jumlah soal 13; menjelaskan cara dengan tingkat kesukaran 0,930 dan jumlah soal 25; informasi waktu, cerita dan bacaan dangn tingkat kesukaran soal 0,945 dan jumlah soal sebanyak 16; identittas tokoh 1,028 dengan jumlah soal Rerata Soal Sains Berdasarkan Level Soal Soal-soal sains dipetakan menjadi tiga level berdasarkan psikologi kognitif: knowing, applying, dan reasoning. Secara umum asumsi kemampuan kognitif terendah adalah knowing. Siswa pada level applying lebih mampu dibandingkan pada level knowing Sedangkan level reasoning dianggap sebagai level kognitif yang tertinggi diantara level yang lain karena siswa telah mampu bernalar dengan kemampuan Siswa mampu mengaitkan permasalahan dalam konteks yang tidak familiar dengan konsep matematika yang diketahuinya Dibawah ini disajikan pemetaan soal berdasarkan level Kode Soal Topik Level S7_01 perubahan wujud benda K1 S7_02 kesehatan panca indra K1 S7_04 rangka manusia K1 S7_05 hidung K1 S7_06 struktur akar dan fungsinya K1 S7_07 cahaya dan sifatnya K1 S7_08 cahaya dan penglihatan K1 S7_09 daur hidup K1 S7_10 struktur bumi K1 S1_01 gaya K1 S1_02 kesehatan panca indra K1 S1_03 daur hidup K1 S1_04 dampak pengambilan bahan alam K1 S1_05 rangka manusia K1 S1_09 struktur bunga dan fungsinya K1 S1_11 wujud benda dan sifatnya K1 Indonesia National Assessment Programme (INAP) 115

116 Kode Soal Topik Level S1_12 energi bunyi dan alat musik K1 S2_01 kerusakan lingkungan K1 S2_03 simbiosis dan rantai makanan K1 S2_05 kerusakan lingkungan K1 S2_07 posisi bulan K1 S2_08 wujud benda dan sifatnya K1 S2_10 panas K1 S2_12 hewan peliharaan K1 S8_01 wujud benda dan sifatnya K1 S8_02 panas K1 S8_03 pemeliharaan kesehatan kerangka tubuh K1 S8_05 gaya K1 S8_06 simbiosis dan rantai makanan K1 S8_07 sumber daya alam dan teknologi K1 S8_08 ekosistem K1 S8_09 sumber daya alam K1 S8_10 sumber daya alam K1 S8_11 rangka manusia dan fungsinya K1 S3_03 mata K1 S3_04 perubahan wujud benda K1 S3_05 struktur bunga dan fungsinya K1 S3_06 daur hidup K1 S3_07 energi alternatif K1 S3_08 perubahan wujud benda K1 S4_02 energi alternatif K1 S4_03 energi bunyi dan alat musik K1 S4_04 posisi bulan K1 S4_06 energi alternatif K1 S4_07 struktur batang dan fungsinya K1 S5_01 sumber daya alam K1 S5_02 pemeliharaan kesehatan kerangka tubuh K1 Indonesia National Assessment Programme (INAP) 116

117 Kode Soal Topik Level S5_03 energi gerak K1 S5_06 rangka manusia dan fungsinya K1 S5_07 struktur daun dan fungsinya K1 S5_08 sifat bahan dan kegunaannya K1 S5_09 perubahan lingkungan fisik terhadap daratan K1 S6-01 struktur bunga dan fungsinya K1 S6-02 energi bunyi dan alat musik K1 S6-03 struktur akar dan fungsinya K1 S6-04 kepedulian terhadap hewan peliharaan K1 S6-07 wujud benda dan sifatnya K1 S6-09 gaya K1 S6-11 kepedulian terhadap hewan peliharaan K1 S6-12 daur hidup K1 S7_03 kenampakan bumi K2 S1_06 struktur daun K2 S2_02 wujud benda dan sifatnya K2 S2_04 gaya K2 S2_06 simbiosis dan rantai makanan K2 S2_11 sumber daya alam dan teknologi K2 S8_04 ekosistem K2 S3_01 energi bunyi dan alat musik K2 S3_10 perubahan wujud benda K2 S3_11 rangka manusia dan fungsinya K2 S4_05 gaya K2 S4_09 gaya K2 S4_11 perubahan lingkungan fisik terhadap daratan K2 S5_11 energi alternatif K2 S6-05 penggolongan hewan berdasarkan jenis K2 makanannya S1_07 perubahan sifat benda K3 S1_08 ekosistem K3 S1_10 daur hidup K3 Indonesia National Assessment Programme (INAP) 117

118 Kode Soal Topik Level S2_09 panca indra dan fungsinya K3 S3_02 wujud benda dan sifatnya K3 S3_09 sumber daya alam dan teknologi K3 S3_12 ekosistem K3 S4_01 sumber daya alam K3 S4_08 simbiosis dan rantai makanan K3 S4_10 penggolongan hewan berdasarkan jenis K3 makanannya S5_04 sifat bahan dan kegunaannya K3 S5_05 daur hidup K3 S5_10 kepedulian terhadap hewan peliharaan K3 S5_12 sumber daya alam K3 S6-06 struktur akar dan fungsinya K3 S6-08 gaya K3 S6-10 mata K3 Level K-1 berarti soal pada kompetensi dasar tersebut berada pada level knowing. Level K-2 berarti soal pada kompetensi dasar tersebut berada pada level applying. Level K-3 berarti soal pada kompetensi dasar tersebut berada pada level reasoning. Dari tabel di atas pada soal sains terlihat bawa untuk level K-1 ( knowing) ada 60 soal atau 65% untuk level K-2 (applying) ada 15 soal atau 16% sedangkan level tertinggi yaitu K-3 (reasoning) terdapat 17 soal atau 19%. Sebaran persentase soal berdasarkan level kognitif tersaji pada grafik berikut: Indonesia National Assessment Programme (INAP) 118

119 Sebaran Persentase Soal Berdasarkan Level Kognitif 19% 16% 65% Knowing Applying Reasoning Dari sebaran soal berdasarkan level kognitif tersebut dapat dipetakan berdasarkan tingkat kesukaran. Adapun rerata tingkat kesukaran soal berdasarkan level kognitif adalah sebagai berikut: Tingkat Kesukaran Soal Berdasarkan Level Kognitif Knowing Applying Reasoning Tingkat Kesukaran Soal 0,899 0,954 0,726 Jumlah Soal Dari diagram di atas terlihat bahwa tingkat kesukaran soal sains berdasarkan level kognitif adalah sebagai berikut level knowing dengan jumlah soal 60 tingkat kesukarannya adalah 0,899; level applying dengan jumlah soal 15 tingkat Indonesia National Assessment Programme (INAP) 119

120 kesukarannya adalah 0,954; level reasoning kesukarannya adalah 0,726 dengan jumlah soal 17 tingkat Pemetaan berdasarkan tingkat kesukaran topik/standar Kompetensi disajikan pada tabel berikut : Topik Rata-Rata Tingkat Kesukaran Jumlah Soal Benda dan Sifatnya 0, Energi dan perubahannya 0, Bumi dan Alam Semesta 0, Makhluk Hidup dan proses kehidupan 1, Rerata Tingkat Kesukaran Soal Berdasarkan Topik 45, , , , , , , ,0000 5,0000 0,0000 Rata-Rata Tingkat Kesukaran Jumlah Soal Dari data di atas dapat kita urutkan rerata tingkat kesukaran soal dari yang terendah sampai yang tersulit berdasarkan topiknya adalah sebagai berikut: Benda dan sifatnya rata-rata tingkat kesukaran 0,878 dengan jumlah soal 13; Bumi dan alam semesta dengan tingkat kesukaran 0,882 dan jumlah soal 18; Energi dan perubahannya rata-rata tingkat kesukaran 0,9180 dengan jumlah soal 20; Makhluk hidup dan proses kehidupannya 1,078 dengan jumlah soal 41. Indonesia National Assessment Programme (INAP) 120

121 E. Contoh butir-butir soal INAP yang setara dengan soal internasional Berikut contoh butir soal INAP yang ditulis pada level nasional namun memiliki karakter butir yang sebanding dengan butir internasional setelah dikalibrasi pada skala yang sama. 1. Soal Matematika BT4_Bin_Mat 3 Pada tahun 2006, Kakek Abdul Azis berusia abad. Usia Kakek Abdul Azis pada 4 tahun 2011 adalah windu. Soal ini merupakan soal mengenai pola operasi hitung bilangan pecahan pada level reasoning. Butir tersebut sebenarnya setara dengan butir internasional yang meminta siswa untuk menentukan formula yang tepat agar dihasilkan pola bilangan yang disajikan. BT5 _Bin_Mat Ebru menggunakan sebuah rumus untuk memperoleh bilangan pada yang berasal dari bilangan di. Manakah rumus yang tepat? A. Kalikan dengan 1 lalu tambah 5. B. Kalikan dengan 2 lalu tambah 2. C. Kalikan dengan 3 lalu kurang 1. D. Kalikan dengan 4 lalu kurang 4. Namun soal nasional INAP lebih tinggi tingkat kesukarannya karena siswa tidak diberikan pilihan jawaban mengenai rumus yang digunakan. Pilihan jawaban Indonesia National Assessment Programme (INAP) 121

122 merupakan hasil hitung terhadap pasangan bilangan yang baru. Soal INAP yang disajikan sebelumnya tidak memberi peluang kepada siswa untuk mencoba formula pada pilihan jawaban agar dihasilkan pola yang sesuai sebagaimana pada soal internasional. Contoh berikut ini adalah contoh soal pada level knowing dengan topik membandingkan dua pecahan biasa. Daya beda soal adalah dengan tingkat kesukaran pada soal ini siswa diminta menuliskan lambang persamaan aritmatika yang paling sesuai menggambarkan perbandingan dua bilangan pecahan yang disajikan. BT3_Bin_Mat Tuliskan tanda <, =, atau tanda > pada titik-titik berikut, sehingga menjadi kalimat yang benar Jawab : Soal nasional tersebut setara dengan soal internasional yang juga mengukur kemampuan siswa menelaah persamaan aritmatika, namun soal internasional tidak menggunakan stimulus berupa bilangan pecahan. Berikut contoh soal internasional yang setara dengan soal BT8_Bin_Mat Adalah banyak pensil yang dipunyai Pandu. Kiki memberi ke Pandu sebanyak 3 pensil. Berapa banyak pensil Pandu sekarang? A. 3 : B. + 3 C. 3 D. 3 x Indonesia National Assessment Programme (INAP) 122

123 Sedangkan contoh soal INAP untuk level applying terlihat pada soal berikut yang menguji pengetahuan mengenai konsep bilangan pecahan dalam keseharian. Sebenarnya konteks aplikasi dari soal ini masih sederhana dan familiar bagi siswa karena konteks inilah yang memang biasa disajikan di pembelajaran maupun di buku teks. Namun soal ini sudah lebih dari sekedar mengetahui bilangan pecahan karena diaplikasikan untuk masalah sederhana dikehidupan. BT3_Bin_Mat 1 1 Ibu membuat sebuah kue bolu. bagian dari kue tersebut diberikan pada ayah, 2 8 bagian diberikan kepada Adik. Berapa bagian kue bolu yang tersisa? Jawab : Contoh soal internasional yang setara dengan soal INAP adalah soal ( BT4_Bin_Mat) berikut: 1 1 Tono makan roti bagian dan Deni makan bagian. Berapa bagian kue yang 2 4 mereka makan? Jawab : Perbandingan soal-soal nasional INAP dengan soal internasional baik dari segi konten maupun statistik butir soal menunjukkan bahwa INAP merupakan asesmen yang bersifat nasional namun dapat disandingkan kualitasnya dengan asesmen tingkat internasional. Indonesia National Assessment Programme (INAP) 123

124 2. Soal Membaca BT1_Bin_Mat Segumpal Tanah Liat oleh Diana Engel DDi lantai atas, di dalam sebuah menara tua, pernah ada tempat kerja. Tempat itu adalah tempat pembuatan keramik, penuh dengan cat warna-warni, alat pemutar keramik, tungku pembakaran, dan tentu saja tanah liat. Dekat jendela ada sebuah tempat penyimpanan besar yang terbuat dari kayu dengan pintu penutup yang kuat. Di sanalah tanah liat itu disimpan. Di bagian paling bawah, hampir di pojok tempat itu, ada segumpal tanah liat yang sudah lama berada di sana. Dia hampir tidak ingat kapan terakhir dia diambil untuk dibuat keramik. Setiap hari pintu penutup yang kuat itu dibuka. Tangan-tangan dengan cepat meraih dan mengambil bongkahan atau bulatan tanah liat itu. Segumpal tanah liat itu dapat mendengarkan betapa gembiranya orang-orang yang sibuk bekerja di sana. Kapan aku mendapat giliran? tanyanya. Seiring hari berlalu, di dalam penyimpanan yang gelap, segumpal tanah liat itu kehilangan harapan. Suatu hari, sekumpulan anak datang ke tempat itu bersama dengan gurunya. Tangan-tangan kecil itu mengambil tanah liat di penyimpanan. Hanya segumpal tanah liat itu yang tersisa untuk diambil, akhirnya dia keluar juga! Inilah kesempatanku yang paling besar! dia pikir sambil memicingkan ke cahaya. Seorang anak menyimpan tanah liat itu ke dalam alat pemutar dan memutarnya sekencang mungkin. Ini sungguh menyenangkan! pikir si Tanah Liat. Anak itu mencoba menarik tanah liat itu ke atas sambil terus memutarkannya. Si Tanah Liat itu merasa sangat senang karena dia telah menjadi sesuatu! Setelah mencoba membuat sebuah mangkuk, si anak kecil itu akhirnya menyerah. Tanah liat itu dileburkannya lagi dan dibulatkan menjadi mirip sebuah bola. Sudah waktunya untuk membersihkan diri! kata Pak Guru. Dan tempat kerja itu pun ramai dengan suara anak-anak menggosok, menyabuni, membilas, dan mengeringkan tangannya. Air berceceran di mana-mana. Anak kecil itu menyimpan bola tanah liat itu di dekat jendela dan bergegas bergabung dengan temantemannya. Sesaat kemudian, tempat itu pun menjadi kosong. Ruangan menjadi Indonesia National Assessment Programme (INAP) 124

125 sangat sepi dan gelap. Si Tanah Liat sangat ketakutan. Tidak saja dia kehilangan tempatnya yang nyaman di dalam tempat penyimpanan yang lembab, dia tahu bahwa dia berada dalam bahaya. Habislah sudah, dia pikir. Aku akan tinggal di sini dan mengering, sekering batu. Dia duduk di dekat jendela yang terbuka, tidak dapat bergerak. Dia merasakan cairan yang keluar dari tubuhnya. Sinar mentari mulai meredup, dan angin malam mulai berhembus. Sampai akhirnya dia mengeras sekeras batu. Dia sedemikian keras, sehingga tidak lagi mampu berpikir. Dia hanya tahu bahwa dia sudah tidak punya harapan lagi. Namun, jauh di dalam tubuh si Tanah Liat, setitik air masih tersisa dan dia tidak ingin air itu meninggalkan dirinya. Hujan, pikirnya. Air, keluhnya. Ya Tuhan, akhirnya dia berkata lirih di sela-sela harapannya yang sudah mengering. Segumpal awan yang sedang lewat merasa kasihan kepada si Tanah Liat, dan sebuah keajaiban terjadi. Hujan yang sangat lebat tiba-tiba jatuh menyirami jendela yang terbuka, membasuhi si Tanah Liat. Hujan turun semalaman, dan pagi hari, si Tanah Liat akhirnya kembali lunak seperti sediakala. Suara menjadi gaduh di tempat kerja itu. Ya ampun! ujar seorang wanita. Dia adalah pembuat keramik yang sering mengunjungi tempat tersebut. Jendela ini lupa ditutup selama akhir pekan! Lihat, tempat ini menjadi kotor sekali. Kau boleh bermain-main dengan tanah liat, Ibu mau mengambil lap pembersih, katanya kepada anak gadisnya. Si gadis kecil itu melihat segumpal tanah liat di dekat jendela. Indonesia National Assessment Programme (INAP) 125

126 Wah kebetulan sekali ada tanah liat di sini, cocok sekali, katanya. Tak lama kemudian si gadis kecil menekan dan meremas-remas si Tanah Liat menjadi bentuk yang dia inginkan. Bagi si Tanah Liat, jari-jari si gadis kecil itu seperti sentuhan lembut yang sangat menyenangkan. Si gadis terus bekerja sambil berpikir. Tangannya bergerak membentuk sesuatu. Si Tanah Liat merasakan tangan halus gadis itu membentuknya menjadi sebuah benda bundar dengan lorong kosong di tengahnya. Dengan sejumput tanah liat, dibentuknya pegangan untuk tangan. Ibu, ibu, panggil si gadis kecil, Aku membuat cangkir! Bagus sekali! ujar ibunya. Simpan saja di dalam rak, nanti kita bakar di dalam tungku. Kau dapat mengecatnya dengan warna kesukaanmu. Tak lama kemudian si cangkir kecil itu telah siap dibawa ke rumahnya yang baru. Sekarang dia tinggal di rak dapur, berdekatan dengan cangkir-cangkir lainnya, piring, serta peralatan dapur. Mereka tampak berbeda satu dari lainnya. Beberapa cangkir itu ada yang sangat indah. Sarapan pagi sudah siap! panggil si ibu sambil menyiapkan cangkir baru itu yang kemudian diisinya dengan coklat panas. Si gadis kecil memegangnya erat-erat. Betapa senangnya si cangkir dengan garis-garis lembut dalam bentuknya yang baru. Betapa dia telah bekerja dengan baik! Si cangkir kecil itu duduk dengan bangga. Akhirnya akhirnya aku menjadi sesuatu. Indonesia National Assessment Programme (INAP) 126

127 Pertanyaan 1 Urutkan kalimat di bawah ini sesuai dengan peristiwa yang terjadi di dalam bacaan! Nomor 1 telah dikerjakan untuk kamu. Air hujan telah membuat segumpal tanah liat itu menjadi berair dan lunak. Seorang anak laki-laki mencoba membuat segumpal tanah liat itu menjadi sebuah mangkuk. Seorang anak gadis membentuk segumpal tanah liat itu menjadi sebuah cangkir. Segumpal tanah liat itu menjadi kering. 1 Segumpal tanah liat itu ada di tempat penyimpanan. Pertanyaan 2 Mengapa segumpal tanah liat itu demikian lama berada di tempat penyimpanan? Jawab : Pertanyaan 3 Pada awal cerita, segumpal tanah liat itu mengharapkan apa? Jawab : Soal di atas setara dengan soal nasional BT3_Bin_Mat Manfaat Singkong Bayu Krisnamurti adalah seorang pakar pertanian. Dalam kesehariannya beliau selalu mencurahkan buah pikirannya untuk memikirkan nasib para petani. Salah satu buah pikirannya adalah beliau memikirkan agar ada peningkatan nilai ekonomi singkong. Dengan demikian, akan meningkatkan harkat dan martabat kaum petani. Di Sukabumi, Jawa Barat, misalnya, kini sejumlah angkutan kota (angkot) sudah terbiasa mencampur bensin dengan etanol dari singkong. Lain lagi di Gunung Kidul, Yogyakarta, sebuah pabrik modern beroperasi memproduksi tiwul instan. Semua ini adalah cara untuk meningkatkan nilai ekonomi singkong. Indonesia National Assessment Programme (INAP) 127

128 Kadang-kadang akal manusia akan muncul ketika menghadapi situasi yang sulit. Singkong termasuk barang dagangan yang sejak lama tidak masuk dalam hitungan bisnis pertanian. Singkong hanya dijadikan bahan pangan sehingga nilai ekonominya sangat rendah. Contoh di atas membuktikan bahwa singkong mulai dilirik agar mempunyai nilai ekonomi yang tinggi. Di bidang pangan, singkong diangkat sebagai salah satu kekuatan untuk membendung impor gandum. Sedangkan di bidang energi, singkong dapat dimanfaatkan sebagai bahan baku bioenergi, untuk mengurangi penggunaan minyak bumi yang makin menipis. Pertanyaan 4 Siapakah Bayu Krisnamurti itu? Jawab : Jelaskan tujuan peningkatan nilai ekonomi singkong di bidang pangan! Jawab : Soal 1 merupakan soal internasional yang membutuhkan kemampuan siswa memahami bacaan dan mampu mengungkapkan kembali dan menjelaskan apa yang terjadi soal tersebut setara dengan soal yang kedua yang merupakan soal nasional dimana siswa juga diharapkan mampu memahami cerita dan menjelaskan cerita tersebut dengan mengaitkan dengan kehidupan nyata yang bias dilihat dan dibayangkan oleh siswa. Kedua soal tersebut membutuhkan kemampuan berbalar dari siswa. Soal Internasional BT8_Bin_Mat Antartika: Daratan Es Mengenal Antartika Apakah Antartika itu? Antartika adalah benua yang berada di belahan bumi selatan. (Jika kamu mencoba Indonesia National Assessment Programme (INAP) 128

129 mencari di dalam bola dunia, kamu akan menemukannya pada bagian bawah.) Luasnya hampir sepersepuluh dari seluruh permukaan bumi dan diselimuti es setebal meter atau lebih. Kutub Selatan tepatnya berada di tengah-tengah Antartika. Antartika adalah benua yang terdingin, terkering, tertinggi, dan paling berangin. Hanya sedikit orang tinggal di daerah itu. Para ilmuwan tinggal hanya beberapa saat saja, mereka hidup di sebuah tempat yang khusus dibangun untuk penelitian. Musim panas di Antartika berlangsung antara bulan Oktober sampai bulan Maret. Pada waktu ini, hari selalu terang, seterang siang. Pada musim dingin, yaitu bulan April sampai September, kejadian sebaliknya terjadi, dan Antartika selalu gelap, segelap malam selama enam bulan. Cuaca di Antartika Di Antartika selalu lebih dingin daripada apa yang kita bayangkan, termasuk pada musim panas sekalipun! Bagian yang paling dingin adalah di Kutub Selatan. Suhu rata-rata pada bulan Januari, di tengah-tengah musim panas, adalah di bawah 28 derajat Celsius (biasa ditulis -28 o C). Artinya, suhu di sana lebih dingin dari suhu titik beku, yaitu 0 o C. Pada musim dingin, bulan April Indonesia National Assessment Programme (INAP) 129

130 sampai September, suhu rata-rata di Kutub Selatan bisa mencapai -89 o C. Pada suhu sedingin itu, segelas air mendidih yang dilemparkan ke udara akan langsung membeku sebelum air itu jatuh ke permukaan es. Kadang-kadang para ilmuwan harus menggunakan lemari pendingin agar bahan penelitiannya tetap hangat! Penguin di Antartika Jumlah Penguin lebih banyak di Antartika dibandingkan dengan jenis burung lainnya. Mereka tidak dapat terbang tetapi mereka menggunakan sayap pendeknya sebagai sirip untuk berenang. Mereka adalah perenang yang hebat. Di daratan, mereka berjalan atau bergerak dengan melompat-lompat pendek. Penguin memiliki bulu yang lebat. Bulu ini, bersama dengan bulu wool yang ada di bagian dalam, ditambah dengan kulitnya yang tebal dan berlemak, dapat menjaga mereka dari udara, angin dan air yang dingin. Untuk menambah rasa hangat, mereka hidup berkelompok. Surat dari Antartika Sara Wheeler adalah salah seorang ilmuwan yang bekerja di Antartika. Dengan membaca surat kepada keponakannya, Daniel, kamu dapat mempelajari pengalamannya di Antartika. Indonesia National Assessment Programme (INAP) 130

131 Antartika Jum at, 9 Desember Daniel sayang, Ini surat dan foto yang pernah Bibi janjikan akan dikirim dari Antartika. Bayangkan, betapa senangnya Bibi berada di sini, menyusuri langkah yang pernah dilakukan oleh penjelajah terkenal. Di sini jauh sangat berbeda dengan tempat kita. Tidak ada yang segar di sini tidak ada pasar kami harus makan makanan kering, makanan dalam kaleng, atau makanan yang dibekukan (tidak perlu dimasukkan ke dalam lemari es cukup disimpan di luar saja). Kami memasak menggunakan kompor gas kecil, sehingga jauh lebih lama daripada memasak di rumah. Kemarin Bibi memasak mie dengan sambal tomat dan sayuran kalengan, kemudian makan strawberi kering yang rasanya seperti kardus. Bibi ingin sekali apel dan jeruk segar seandainya kamu bisa mengirimkannya untuk Bibi! Dari Bibi Sara Pertanyaan 5 Di sebelah mana kamu dapat menemukan Antartika dalam bola dunia (globe)? Jawab : Bagian Antartika mana yang paling dingin? Jawab : Pertanyaan 6 Cobalah pikirkan apa yang ingin disampaikan oleh bacaan di atas tentang Antartika. Berikan dua alasan mengapa orang mengunjungi Antartika tidak pada bulan antara April dan September! Indonesia National Assessment Programme (INAP) 131

132 Setara dengan soal Nasional BT5_Bin_Mat BERTANAM PEPAYA Tanaman pepaya biasanya diperbanyak dengan biji. Untuk memperoleh bibit yang baik, dapat dilakukan pembibitan sendiri dengan cara perkawinan buatan. Bijibiji yang hendak dipergunakan sebagai bibit diambil dari buah yang sudah masak. Biji yang baik berasal dari pohon-pohon pilihan. Biji-biji dicuci bersih, kemudian dikeringkan. Sebelum ditanam, biji perlu diuji lagi dengan merendam di dalam air. Biji-biji yang tenggelam dipergunakan sebagai bibit. Biji pepaya dapat langsung ditanam di kebun, atau disemaikan lebih dahulu. Tiga-empat biji langsung ditanam dalam satu lubang. Dari tiga-empat biji yang diperoleh, ditinggalkan satu batang saja. Dengan cara penyemaian, biji-biji ditaburkan dalam larikan dengan jarak tanam 5 10 cm. Biji tidak boleh ditanam terlalu dalam, lebih kurang sedalam 1 cm. Bibit yang sudah dewasa, yaitu berumur 2-3 bulan, dapat dipindahkan ke kebun dengan jarak tanam kira-kira 3 m. Tanaman pepaya memerlukan air yang cukup dan banyak pupuk, khususnya pupuk organik. Pemberian pupuk kandang yang pertama diperlukan 2-3 blek. Kemudian, tiap-tiap 3 4 bulan diberi tambahan pupuk yang jumlahnya lebih banyak, pupuk ditaburkan merata di sekeliling tanaman. Hama yang sering menyerang pohon pepaya ialah: tungau daun, burung, kelelawar. Tungau daun dapat diberantas dengan menyemprotkan tepung belerang. Sesudah 9 12 bulan, hasil buah pepaya mulai dipetik. Ada jenis pepaya yang dapat dipetik buahnya semenjak usia 7 8 bulan. Tiap-tiap pohon dapat menghasilkan buah. Sesudah empat bulan lebih, sebaiknya tanaman dibongkar seluruhnya dan diganti dengan tanaman yang baru karena hasil buahnya tidak bagus lagi. Pertanyaan 7 Informasi apa yang terdapat dalam bacaan tersebut? Jawab : Jelaskan cara menanam bibit pepaya yang ditanam langsung di kebun! Jawab : Indonesia National Assessment Programme (INAP) 132

133 Pertanyaan 8 Pohon pepaya memerlukan pupuk. Pupuk ditaburkan merata di... Jawab : Soal internasional di atas bacaan sangat panjang sehingga memerlukan daya nalar yang tinggi begitu juga dengan soal kedua yaitu soal nasional. Dari kedua bacaan tersebut ternyata pertanyaan sangat singkat sehingga siswa-siswa terkecoh dengan bacaannya Indonesia National Assessment Programme (INAP) 133

134 3. Soal Sains Soal di bawah ini merupakan soal nasional. BT10_IPA Setiap hari Ibu Anita memasak untuk keluarganya. Oleh karena itu bumbu dapur di rumahnya tersedia lengkap. Sebutkan 4 (empat) bumbu dapur yang dimiliki Ibu Anita yang bisa larut dalam air! Jawab : Soal di bawah ini merupakan soal internasional BT13_IPA Gambarlah panah pada Sungai Tua untuk menunjukkan arah aliran air pada gambar berikut! Dari kedua soal di atas baik soal nasional dan internasional merupakan soal sederhana yang dihadapi siswa sehari-hari tapi ketika di buat soal dan siswa Indonesia National Assessment Programme (INAP) 134

135 diminta menjawab kedua soal ini termasuk soal yang sulit. Baik itu soal nasional dan soal internasional. Hal ini disebabkan karena siswa kita tidak dibiasakan dengan soal-soal yang berkaitan dengan kehidupan nyata Indonesia National Assessment Programme (INAP) 135

136 BAB V LATAR BELAKANG SISWA DAN HASIL SISWA PADA KEMAMPUAN MATEMATIKA, MEMBACA DAN SAINS 1. Tahun Lahir Frequency SW2C Frequency Valid Cumulative ,0,199, ,1,864 1, ,3 3,059 4, ,0 21,742 25, ,3 68,285 94, ,5 5,186 99, ,0,399 99, ,0,066 99, ,0, ,0 Total ,2 100,000 Jika ditinjau dari tahun kelahiran, paling banyak peserta yakni tahun lahir 2003 sebanyak 68,29%, berikutnya tahun lahir 2002 sebanyak 21,74%, tahun lahir 2004 Indonesia National Assessment Programme (INAP) 136

137 sebanyak 5,19%. Jumlah peserta paling sedikit adalah peserta kelahiran tahun 2006 sebanyak 0,07%. 2. Jumlah Saudara Frequency Total Frequency Valid Cumulative 0 2,0,14, ,2 25,41 25, ,0 33,77 59, ,8 20,72 80, ,9 10,15 90,2 5 56,3 3,87 94,1 6 36,2 2,49 96,5 7 22,1 1,52 98,1 8 7,0,48 98,5 9 9,1,62 99,2 10 3,0,21 99,4 11 3,0,21 99,6 12 4,0,28 99,9 13 1,0,07 99,9 24 1,0,07 100,0 Total ,8 100,0 Jika dilihat dari Jml Saudara kandung maka jumlah terbesar adalah peserta yang mempunyai Jml Saudara kandung sebanyak 2 orang yakni 33,77% diikuti Jml Indonesia National Assessment Programme (INAP) 137

138 Saudara kandung 1 sebanyak 25,41% diikuti Jml Saudara kandung sebanyak 3(20,72%). 3. Anak ke berapa dalam keluarga Frequency Frequency Valid Cumulative ,3 35,36 35, ,9 30,65 66, ,8 18,86 84, ,8 8,19 93,1 5 56,3 3,67 96,7 6 20,1 1,31 98,0 7 15,1 0,98 99,0 8 6,0 0,39 99,4 9 4,0 0,26 99,7 10 2,0 0,13 99,8 12 2,0 0,13 99,9 14 1,0 0,07 100,0 Total ,3 100,0 Jika dilihat dari Anak ke berapa dalam keluarga maka jumlah terbesar adalah peserta yang merupakan anak ke 1 sebanyak 540 orang yakni 35,36% diiuti anak ke 2 ( sebanya 468 orang) atau 30,65% diikuti anak ke3 sebanyak 288orang (18,86%). Indonesia National Assessment Programme (INAP) 138

139 4. Cita Cita Frequency Tentara (Darat/Laut/Udara) Polisi Tenaga Ahli (Dokter/Pilot/Wartawan/ dll) Pengusaha/Wiraswasta Frequenc y Percen t Valid Percen t Cumulativ e Tentara (Darat/Laut/Udara) 231 1,4 15,2 15,2 Polisi 170 1,0 11,2 26,3 Tenaga Ahli 308 1,9 20,2 46,6 (Dokter/Pilot/Wartawan/ dll) Pengusaha/Wiraswasta 67,4 4,4 51,0 Pedagang 11,1,7 51,7 Guru/Dosen/Pengajar 391 2,4 25,7 77,3 Atlet (Sepakbola/bulutangkis/basket/dll) Artis (Penyanyi/pemain film/pelukis/dll) Pemimpin (Presiden/bupati/menteri/gubernur/dl l) 219 1,3 14,4 91,7 59,4 3,9 95,6 20,1 1,3 96,9 Lainnya 47,3 3,1 100,0 Total ,3 100,0 Jika dilihat dari Cita-cita maka jumlah terbesar adalah peserta yang mempunyai Cita-cita Guru/Dosen/Pengajar sebanyak 391 orang yakni 25,67% diiuti Tenaga Indonesia National Assessment Programme (INAP) 139

140 Ahli (Dokter/Pilot/Wartawan/ dll) ( sebanya 308 orang) atau 20,22% dan berikutnya Tentara (Darat/Laut/Udara) sebanyak 231orang (15,17%) 5. Sebutkan Cita-Citamu Frequency Valid Cumulative ,6 99,6 99,6 1, 2,0,0 99,7 6, 2,0,0 99,7 7, 1,0,0 99,7 8, 1,0,0 99,7 ARSITEK 1,0,0 99,7 Bidan 1,0,0 99,7 Bola Kaki dll 1,0,0 99,7 Chef 1,0,0 99,7 Desainer 1,0,0 99,7 Dokter 5,0,0 99,7 Dokter Gigi 1,0,0 99,7 GURU 1,0,0 99,7 AGAMA HAKIM 1,0,0 99,8 JENDRAL 1,0,0 99,8 KOKI 1,0,0 99,8 Koki/ chef 1,0,0 99,8 manager 1,0,0 99,8 Mekanik 1,0,0 99,8 Motor Menjadi Polisi 1,0,0 99,8 Pemain Bola 2,0,0 99,8 Pembalap 1,0,0 99,8 PEMBALAP 1,0,0 99,8 Pengusaha 1,0,0 99,8 Ikan Pengusaha 1,0,0 99,8 Salon Perawat 1,0,0 99,8 Pilot 1,0,0 99,8 PNS 1,0,0 99,8 POLWAN 1,0,0 99,9 Indonesia National Assessment Programme (INAP) 140

141 Frequency Valid Cumulative Pramugara 1,0,0 99,9 pramugari 2,0,0 99,9 Pramugari 8,0,0 99,9 PRAMUGARI 5,0,0 100,0 Pramugari dan Paskibra 1,0,0 100,0 Presiden 1,0,0 100,0 Profesor 1,0,0 100,0 Ilmuan Salon 1,0,0 100,0 Sekretaris 1,0,0 100,0 Sepak Bola 1,0,0 100,0 TNI 1,0,0 100,0 Wira Swasta 1,0,0 100,0 Total ,0 100,0 Jika dilihat dari Sebutkan Cita-citamu maka jumlah terbesar adalah peserta yang mempunyai Sebutkan Cita-citamu ARSITEK sebanyak 1 orang yakni 0,006% diikuti 6, ( sebanyak 2 orang) atau 0,0122%. Indonesia National Assessment Programme (INAP) 141

142 6. Bahasa yg sering dipakai sehari-hari dirumah Frequency Bahasa indonesia Bahasa Daerah Bahasa Asing Frequency Valid Cumulative Bahasa ,9 95,1 95,1 indonesia Bahasa 72,4 4,7 99,8 Daerah Bahasa 3,0,2 100,0 Asing Total ,4 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari Bahasa yg sering dipakai sehari-hari dirumah maka jumlah terbesar adalah peserta yang mempunyai Bahasa yg sering dipakai sehari-hari dirumah Bahasa indonesia sebanyak 1458 orang (95,11%), diikuti Bahasa Daerah sebanyak 72 orang ( 0,2 )% dan berikutnya Bahasa Asing sebanyak 3 orang (0,2%) Indonesia National Assessment Programme (INAP) 142

143 7. Lokasi Rumah Frequency Di kompleks perumahan Di daerah keramaian (dekat pasar/stasiun/terminal) Di perkampungan/gang yang padat penduduk Di pedesaan yang tenang (jauh dari jalan raya) Frequenc y Percen t Valid Percen t Cumulati ve Di kompleks perumahan 215 1,3 14,2 14,2 Di daerah keramaian (dekat 176 1,1 11,6 25,8 pasar/stasiun/terminal) Di perkampungan/gang yang padat 556 3,4 36,7 62,6 penduduk Di pedesaan yang tenang (jauh dari 504 3,1 33,3 95,9 jalan raya) Lainya 62,4 4,1 100,0 Total ,2 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari Lokasi Rumah maka jumlah terbesar adalah peserta yang mempunyai Lokasi Rumah Di perkampungan/gang yang padat penduduk sebanyak 556 orang (36,75%), diikuti Di pedesaan yang tenang (jauh dari jalan raya) sebanyak 504 orang ( 33,31 )% dan berikutnya Di kompleks perumahan sebanyak 215 orang (14,21%) Indonesia National Assessment Programme (INAP) 143

144 8. Tingkat Pendidikan Ayah Frequency 0 Tidak tamat SD/tidak sekolah Tamat SD/MI Tamat SMP/MTs Tamat SMA/Sederajat Tamat D1/D2/D3/Akademi Frequency Valid Cumulative 0 1,0,1,1 Tidak tamat SD/tidak 86,5 5,7 5,8 sekolah Tamat SD/MI 180 1,1 11,9 17,7 Tamat SMP/MTs 295 1,8 19,5 37,2 Tamat 599 3,7 39,7 76,9 SMA/Sederajat Tamat 46,3 3,0 79,9 D1/D2/D3/Akademi Tamat Sarjana (S1) 107,7 7,1 87,0 Tamat Magister (S2) 17,1 1,1 88,1 Tamat Doktor (S3) 3,0,2 88,3 Tidak tahu 176 1,1 11,7 100,0 Total ,2 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari Tingkat pendidikan Ayah maka jumlah terbesar adalah peserta yang mempunyai Tingkat pendidikan Ayah Tamat SMA/Sederajat sebanyak 599 orang (39,67%), diikuti Tamat SMP/MTs sebanyak 295 orang ( 19,54 )% dan berikutnya Tamat SD/MI sebanyak 180 orang (11,92%) Indonesia National Assessment Programme (INAP) 144

145 9. Tingkat Pendidikan Ibu Frequency 0 Tidak tamat SD/tidak sekolah Tamat SD/MI Tamat SMP/MTs Tamat SMA/Sederajat Tamat D1/D2/D3/Akademi Tamat Sarjana (S1) Tamat Magister (S2) Tamat Doktor (S3) Saya tidak tahu Frequency Valid Cumulative 0 2,0,1,1 Tidak tamat SD/tidak 81,5 5,7 5,8 sekolah Tamat SD/MI 181 1,1 12,6 18,4 Tamat SMP/MTs 290 1,8 20,3 38,7 Tamat 525 3,2 36,7 75,4 SMA/Sederajat Tamat 49,3 3,4 78,8 D1/D2/D3/Akademi Tamat Sarjana (S1) 114,7 8,0 86,8 Tamat Magister (S2) 10,1,7 87,5 Tamat Doktor (S3) 11,1,8 88,3 Saya tidak tahu 168 1,0 11,7 100,0 Total ,7 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari Tingkat pendidikan IBU maka jumlah terbesar adalah peserta yang mempunyai Tingkat pendidikan IBU Tamat SMA/Sederajat sebanyak 525 orang (36,69%), diikuti Tamat SMP/MTs sebanyak 290 orang ( 20,27 )% dan berikutnya Tamat SD/MI sebanyak 181 orang (12,65%) Indonesia National Assessment Programme (INAP) 145

146 10. Pekerjaan Ayah Frequency 0 Tentara (Darat/Laut/Udara/Polisi) Tenaga Ahli (Dokter/Pilot/Wartawan/ dll) Pengusaha/Wiraswasta Pedagang Guru/Dosen/Pengajar Petani/bercocok tanam Nelayan/Penangkap Ikan Frequency Valid Cumulative 0 1,0,1,1 Tentara (Darat/Laut/Udara/Polisi) 72,4 4,9 4,9 Tenaga Ahli 23,1 1,6 6,5 (Dokter/Pilot/Wartawan/ dll) Pengusaha/Wiraswasta 580 3,5 39,2 45,7 Pedagang 109,7 7,4 53,1 Guru/Dosen/Pengajar 35,2 2,4 55,4 Petani/bercocok tanam 180 1,1 12,2 67,6 Nelayan/Penangkap Ikan 36,2 2,4 70,0 Supir (angkutan umum/pribadi) 106,6 7,2 77,2 Buruh 204 1,2 13,8 91,0 (tani/angkutan/bangunan/pabrik Tidak bekerja (mengganggur) 20,1 1,4 92,4 Pensiunan 16,1 1,1 93,4 Lainnya 97,6 6,6 100,0 Total ,0 100,0 Indonesia National Assessment Programme (INAP) 146

147 Data pada tabel tersebut menunjukan bahwa jika dilihat dari Pekerjaan Ayah maka jumlah terbesar adalah peserta yang mempunyai Pekerjaan Ayah Pengusaha/Wiraswasta sebanyak 580 orang (39,22%), diikuti Buruh (tani/angkutan/bangunan/pabrik sebanyak 204 orang ( 13,79 )% dan berikutnya Petani/bercocok tanam sebanyak 180 orang (12,17%) 11. Pekerjaan Ibu Frequency 0 Tentara (Darat/Laut/Udara/Polisi) Tenaga Ahli (Dokter/Pilot/Wartawan/ dll) Pengusaha/Wiraswasta Pedagang Frequency Valid Cumulative 0 12,1 1,0 1,0 Tentara 5,0,4 1,4 (Darat/Laut/Udara/Polisi) Tenaga Ahli 28,2 2,3 3,6 (Dokter/Pilot/Wartawan/ dll) Pengusaha/Wiraswasta 232 1,4 18,7 22,3 Pedagang 201 1,2 16,2 38,5 Guru/Dosen/Pengajar 81,5 6,5 45,0 Petani/bercocok tanam 119,7 9,6 54,5 Nelayan/Penangkap Ikan 8,0,6 55,2 Supir (angkutan umum/pribadi) 7,0,6 55,8 Buruh (tani/angkutan/bangunan/pabrik 65,4 5,2 61,0 Indonesia National Assessment Programme (INAP) 147

148 Frequency Valid Cumulative Tidak bekerja (mengganggur) 273 1,7 22,0 82,9 Pensiunan 21,1 1,7 84,6 Lainnya 191 1,2 15,4 100,0 Total ,6 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari Pekerjaan Ibu maka jumlah terbesar adalah peserta yang mempunyai Pekerjaan Ibu Tidak bekerja (mengganggur) sebanyak 273 orang (21,96%), diikuti Pengusaha/Wiraswasta sebanyak 232 orang ( 18,66 )% dan berikutnya Pedagang sebanyak 201 orang (16,17%) 12. Kondisi Rumah Frequency Sederhana (papan/bambu dan kecil) Sedang (Papan/tembok dan cukup besar) Bagus (Tembok/marmer dan besar) Frequency Valid Cumulative Sederhana (papan/bambu dan 150,9 10,0 10,0 kecil) Sedang (Papan/tembok dan 798 4,9 53,3 63,3 cukup besar) Bagus (Tembok/marmer dan 549 3,4 36,7 100,0 besar) Total ,1 100,0 Indonesia National Assessment Programme (INAP) 148

149 Data pada tabel tersebut menunjukan bahwa jika dilihat dari Kondisi rumah maka jumlah terbesar adalah peserta yang mempunyai Kondisi rumah Sedang (Papan/tembok dan cukup besar) sebanyak 798 orang (53,31%), diikuti Bagus (Tembok/marmer dan besar) sebanyak 549 orang ( 36,67 )% dan berikutnya Sederhana (papan/bambu dan kecil) sebanyak 150 orang (10,02%). 13. Memiliki Radio Kaset Frequency 0 Ya Tidak Frequency Valid Cumulative 0 10,1,9,9 Ya 870 5,3 75,1 75,9 Tidak 278 1,7 24,0 99,9 3 1,0,1 100,0 Total ,1 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Radio/kaset maka jumlah terbesar adalah peserta yang menjawab Ya sebanyak 870 orang (75,06%), diikuti Tidak sebanyak 278 orang ( 23,99 )% Indonesia National Assessment Programme (INAP) 149

150 14. Memiliki Televisi Frequency 0 Ya Tidak Frequency Valid Cumulative 0 1,0,1,1 Ya ,2 97,0 97,1 Tidak 40,2 2,9 100,0 Total ,5 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Televisi maka jumlah terbesar adalah peserta yang menjawab Ya sebanyak 1347 orang (97,05%), diikuti Tidak sebanyak 40 orang ( 2,88 )% Indonesia National Assessment Programme (INAP) 150

151 15. Memiliki Kulkas atau lemari es Frequency 0 Ya Tidak Frequency Valid Cumulative 0 8,0,7,7 Ya 966 5,9 80,3 81,0 Tidak 229 1,4 19,0 100,0 Total ,3 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Kulkas/lemari es maka jumlah terbesar adalah peserta yang menjawab Ya sebanyak 966 orang (80,3%), diikuti Tidak sebanyak 229 orang ( 19,04 )% Indonesia National Assessment Programme (INAP) 151

152 16. Memiliki Mesin Cuci Frequency 0 Ya Tidak Frequency Valid Cumulative 0 12,1 1,1 1,1 Ya 522 3,2 48,2 49,4 Tidak 548 3,3 50,6 100,0 Total ,6 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Mesin cuci maka jumlah terbesar adalah peserta yang menjawab Tidak sebanyak 548 orang (50,65%), diikuti Ya sebanyak 522 orang ( 48,24 )% Indonesia National Assessment Programme (INAP) 152

153 17. Memiliki Video/DVD/VCD Frequency 0 Ya Tidak Frequency Valid Cumulative 0 13,1 1,2 1,2 Ya 816 5,0 72,4 73,6 Tidak 298 1,8 26,4 100,0 Total ,9 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Video/DVD/VCD player maka jumlah terbesar adalah peserta yang menjawab Ya sebanyak 816 orang (72,4%), diikuti Tidak sebanyak 298 orang ( 26,44 )% Indonesia National Assessment Programme (INAP) 153

154 18. Memiliki Sambungan Internet Frequency 0 Ya Tidak Frequency Valid Cumulative 0 17,1 1,8 1,8 Ya 168 1,0 17,4 19,2 Tidak 779 4,8 80,8 100,0 Total 964 5,9 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Sambungan internet maka jumlah terbesar adalah peserta yang menjawab Tidak sebanyak 779 orang (80,81%), diikuti Ya sebanyak 168 orang ( 17,43 )% Indonesia National Assessment Programme (INAP) 154

155 19. Memiliki Komputer atau Laptop Frequency Valid 0 Valid Ya Valid Tidak Frequency Valid Cumulative Valid 0 14,1 1,3 1,3 Ya 430 2,6 41,2 42,6 Tidak 599 3,7 57,4 100,0 Total ,4 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Komputer/labtop maka jumlah terbesar adalah peserta yang menjawab Tidak sebanyak 599 orang (57,43%), diikuti Ya sebanyak 430 orang ( 41,23 )% Indonesia National Assessment Programme (INAP) 155

156 20. Memiliki Pendingin Ruangan Frequency 0 Ya Tidak Frequency Valid Cumulative 0 17,1 1,8 1,8 Ya 195 1,2 20,1 21,9 Tidak 756 4,6 78,1 100,0 Total 968 5,9 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Pendingin ruangan (AC) maka jumlah terbesar adalah peserta yang menjawab Tidak sebanyak 756 orang (78,1%), diikuti Ya sebanyak 195 orang ( 20,14 )% Indonesia National Assessment Programme (INAP) 156

157 21. Memiliki Alat Transportasi Frequency Valid 0 Valid Ya Valid Tidak Frequency Valid Cumulative Valid 0 5,0,4,4 Ya ,3 88,8 89,2 Tidak 126,8 10,8 100,0 Total ,1 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Alat transportasi (Sepeda motor,perahu motor) maka jumlah terbesar adalah peserta yang menjawab Ya sebanyak 1040 orang (88,81%), diikuti Tidak sebanyak 126 orang (10,76 )% Indonesia National Assessment Programme (INAP) 157

158 22. Orang-Orang Yang Tinggal di Rumah : Ayah Frequency 0 Ya Tidak Frequency Valid Cumulative 0 1,0,1,1 Ya ,4 97,2 97,3 Tidak 38,2 2,7 100,0 Total ,6 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Orangorang yang tinggal dirumah: Ayah maka jumlah terbesar adalah peserta yang menjawab Ya sebanyak 1373 orang (97,24%), diikuti Tidak sebanyak 38 orang (2,69)% Indonesia National Assessment Programme (INAP) 158

159 23. Orang-Orang Yang Tinggal Di Rumah : Ibu Frequency 0 Ya Tidak Frequency Valid Cumulative 0 5,0,4,4 Ya ,3 98,0 98,4 Tidak 23,1 1,6 100,0 Total ,5 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Orangorang yang tinggal dirumah: Ibu maka jumlah terbesar adalah peserta yang menjawab Ya sebanyak 1367 orang (97,99%), diikuti Tidak sebanyak 23 orang (1,65)% Indonesia National Assessment Programme (INAP) 159

160 24. Orang-Orang Yang Tinggal Di Rumah : Kakak/Adik Frequency 0 Ya Tidak Frequency Valid Cumulative 0 9,1,7,7 Ya ,2 91,9 92,6 Tidak 94,6 7,4 100,0 Total ,8 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Orangorang yang tinggal dirumah: Kakak/Adik maka jumlah terbesar adalah peserta yang menjawab Ya sebanyak 1173 orang (91,93%), diikuti Tidak sebanyak 94 orang (7,37)% Indonesia National Assessment Programme (INAP) 160

161 25. Orang-Orang Yang Tinggal Dirumah : Saudara/Kerabat Frequency 0 Ya Tidak Frequency Valid Cumulative 0 17,1 1,8 1,8 Ya 278 1,7 30,0 31,9 Tidak 631 3,9 68,1 100,0 Total 926 5,7 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Orangorang yang tinggal dirumah: Saudara/kerabat maka jumlah terbesar adalah peserta yang menjawab Tidak sebanyak 631 orang (68,14%), diikuti Ya sebanyak 278 orang ( 30,02 )% Indonesia National Assessment Programme (INAP) 161

162 26. Orang-Orang Yang Tinggal Di Rumah : Kakek/Nenek Frequency 0 Ya Tidak Frequency Valid Cumulative 0 22,1 2,3 2,3 Ya 385 2,4 39,7 42,0 Tidak 562 3,4 58,0 100,0 Total 969 5,9 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Orangorang yang tinggal dirumah: Kakek/nenek maka jumlah terbesar adalah peserta yang menjawab Tidak sebanyak 562 orang (58%), diikuti Ya sebanyak 385 orang ( 39,73 )% Indonesia National Assessment Programme (INAP) 162

163 27. Orang-orang yang tinggal dirumah: Pengasuh anak/baby sitter Frequency 0 Ya Tidak Frequency Valid Cumulative 0 23,1 2,8 2,8 Ya 36,2 4,4 7,2 Tidak 761 4,6 92,8 100,0 Total 820 5,0 100,0 Data pada tabel tersebut menunjukan bahwa jika dilihat dari keberadaan Orangorang yang tinggal dirumah: Pengasuh anak/baby sitter maka jumlah terbesar adalah peserta yang menjawab Tidak sebanyak 761 orang (92,8%), diikuti Ya sebanyak 36 orang ( 4,39 )% Indonesia National Assessment Programme (INAP) 163

Mata pelajaran Bahasa Indonesia bertujuan agar peserta didik memiliki kemampuan sebagai berikut :

Mata pelajaran Bahasa Indonesia bertujuan agar peserta didik memiliki kemampuan sebagai berikut : 07. Mata Pelajaran Bahasa Indonesia A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta didik dan merupakan penunjang keberhasilan dalam mempelajari

Lebih terperinci

31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI)

31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI) 31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta didik

Lebih terperinci

35. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunalaras (SDLB-E)

35. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunalaras (SDLB-E) 35. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunalaras (SDLB-E) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta didik

Lebih terperinci

32. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunanetra (SDLB-A)

32. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunanetra (SDLB-A) 32. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunanetra (SDLB-A) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta didik

Lebih terperinci

34. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunadaksa (SDLB-D)

34. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunadaksa (SDLB-D) 34. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunadaksa (SDLB-D) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta didik

Lebih terperinci

Kelas Tema Materi Waktu P1 Diri sendiri Mendengarkan

Kelas Tema Materi Waktu P1 Diri sendiri Mendengarkan Kelas Tema Materi Waktu P1 Diri sendiri Juli Membedakan berbagai bunyi bahasa Memperkenalkan diri sendiri dengan kalimat sederhana dengan bahasa yang santun nyaring suku kata dengan lafal Menyalin berbagai

Lebih terperinci

31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI)

31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI) 31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta didik

Lebih terperinci

SEKOLAH DASAR (SD) / MADRASAH IBTIDAIYAH (MI)

SEKOLAH DASAR (SD) / MADRASAH IBTIDAIYAH (MI) MATA PELAJARAN : BAHASA INDONESIA KELAS IV SEMESTER 1 SEKOLAH DASAR (SD) / MADRASAH IBTIDAIYAH (MI) PROGRAM TAHUNAN Mata Pelajaran : Bahasa Indonesia Satuan Pendidikan : Tahun Pelajaran : Kelas : IV Smt

Lebih terperinci

33. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunarungu (SDLB B)

33. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunarungu (SDLB B) 33. Mata Pelajaran Bahasa Indonesia untuk Sekolah Dasar Luar Biasa Tunarungu (SDLB B) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta didik

Lebih terperinci

08. Mata Pelajaran Matematika A. Latar Belakang B. Tujuan

08. Mata Pelajaran Matematika A. Latar Belakang B. Tujuan 08. Mata Pelajaran Matematika A. Latar Belakang Matematika merupakan ilmu universal yang mendasari perkembangan teknologi modern, mempunyai peran penting dalam berbagai disiplin dan memajukan daya pikir

Lebih terperinci

37. Mata Pelajaran Matematika untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI)

37. Mata Pelajaran Matematika untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI) 37. Mata Pelajaran Matematika untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI) A. Latar Belakang Matematika merupakan ilmu universal yang mendasari perkembangan teknologi modern, mempunyai peran penting

Lebih terperinci

KURIKULUM TINGKAT SATUAN PENDIDIKAN (KTSP)

KURIKULUM TINGKAT SATUAN PENDIDIKAN (KTSP) KTSP Perangkat Pembelajaran Sekolah Menengah Pertama (SMP)/Madrasah Tsanawiyah (MTs) PERANGKAT PEMBELAJARAN STANDAR KOMPETENSI DAN KOMPETENSI DASAR Mata Pelajaran Satuan Pendidikan Kelas/Semester : Bahasa

Lebih terperinci

41. Mata Pelajaran Matematika untuk Sekolah Dasar Luar Biasa Tunalaras (SDLB-E)

41. Mata Pelajaran Matematika untuk Sekolah Dasar Luar Biasa Tunalaras (SDLB-E) 41. Mata Pelajaran Matematika untuk Sekolah Dasar Luar Biasa Tunalaras (SDLB-E) A. Latar Belakang Matematika merupakan ilmu universal yang mendasari perkembangan teknologi modern, mempunyai peran penting

Lebih terperinci

34. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Pertama Luar Biasa Tunadaksa(SMPLB D)

34. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Pertama Luar Biasa Tunadaksa(SMPLB D) 34. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Pertama Luar Biasa Tunadaksa(SMPLB D) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta

Lebih terperinci

31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Pertama (SMP)/Madrasah Tsanawiyah (MTs)

31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Pertama (SMP)/Madrasah Tsanawiyah (MTs) 31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Pertama (SMP)/Madrasah Tsanawiyah (MTs) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional

Lebih terperinci

34. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas Luar Biasa Tunarungu (SMALB B)

34. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas Luar Biasa Tunarungu (SMALB B) 279 34. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas Luar Biasa Tunarungu (SMALB B) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional

Lebih terperinci

37. Mata Pelajaran Matematika untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI)

37. Mata Pelajaran Matematika untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI) 37. Mata Pelajaran Matematika untuk Sekolah Dasar (SD)/Madrasah Ibtidaiyah (MI) A. Latar Belakang Matematika merupakan ilmu universal yang mendasari perkembangan teknologi modern, mempunyai peran penting

Lebih terperinci

KURIKULUM TINGKAT SATUAN PENDIDIKAN (KTSP)

KURIKULUM TINGKAT SATUAN PENDIDIKAN (KTSP) PERANGKAT PEMBELAJARAN STANDAR KOMPETENSI DAN KOMPETENSI DASAR Mata Pelajaran : Bahasa Indonesia Satuan Pendidikan : SMP/MTs. Kelas : VII, VIII, IX Nama Guru : Dwi Agus Yunianto, S.Pd. NIP/NIK : 19650628

Lebih terperinci

07. Mata Pelajaran Bahasa Indonesia. A. Latar Belakang

07. Mata Pelajaran Bahasa Indonesia. A. Latar Belakang 07. Mata Pelajaran Bahasa Indonesia A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta didik dan merupakan penunjang keberhasian dalam mempelajari

Lebih terperinci

33. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas Luar Biasa Tunanetra (SMALB A)

33. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas Luar Biasa Tunanetra (SMALB A) 271 33. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas Luar Biasa Tunanetra (SMALB A) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional

Lebih terperinci

1. KOMPETENSI INTI DAN KOMPETENSI DASAR BAHASA INDONESIA SD/MI

1. KOMPETENSI INTI DAN KOMPETENSI DASAR BAHASA INDONESIA SD/MI SALINAN LAMPIRAN PERATURAN MENTERI PENDIDIKAN DAN KEBUDAYAAN NOMOR 24 TAHUN 2016 TENTANG KOMPETENSI INTI DAN PELAJARAN PADA KURIKULUM 2013 PADA PENDIDIKAN DASAR DAN PENDIDIKAN MENENGAH 1. KOMPETENSI INTI

Lebih terperinci

Silabus dan Rencana Pelaksanaan Pembelajaran (RPP)

Silabus dan Rencana Pelaksanaan Pembelajaran (RPP) Karsidi MODEL Silabus dan Rencana Pelaksanaan Pembelajaran (RPP) Inilah Bahasa Indonesiaku untuk Kelas VI SD dan MI 6 Berdasarkan Permendiknas Nomor 22 Tahun 2006 tentang Standar Isi dan Permendiknas Nomor

Lebih terperinci

31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Pertama (SMP)/Madrasah Tsanawiyah (MTs)

31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Pertama (SMP)/Madrasah Tsanawiyah (MTs) 31. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Pertama (SMP)/Madrasah Tsanawiyah (MTs) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional

Lebih terperinci

STRUKTUR KURIKULUM KTSP

STRUKTUR KURIKULUM KTSP STRUKTUR KURIKULUM KTSP No. Komponen KTSP SD Kelas MATA PELAJARAN 1 2 3 4 5 6 A. Mata Pelajaran 3 3 3 1. Pendidikan 2 2 2 2. Pendidikan Kewarganegaraan 5 5 5 3. Bahasa Indonesia 5 5 5 4. Matematika 4 4

Lebih terperinci

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS V SEMESTER 2

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS V SEMESTER 2 PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS V SEMESTER 2 1 PROGRAM SEMESTER TAHUN PELAJARAN 20 / 20 MATA PELAJARAN : Bahasa Indonesia KELAS / SEMESTER : V (Lima) / 2 (dua) Standar Kompetensi

Lebih terperinci

Contoh File KKM, PROTA, PROMES, SILABUS, RPP, SK & KD, PEMETAAN

Contoh File KKM, PROTA, PROMES, SILABUS, RPP, SK & KD, PEMETAAN Ini adalah Contoh: Jika ada yang berminat dengan Format *.Doc Silahkan kontak: Telp/SMS : 085 255 989 455 Website : http://bit.ly/rppkita Terima kasih! PERANGKAT PEMBELAJARAN STANDAR KOMPETENSI DAN KOMPETENSI

Lebih terperinci

KRITERIA KETUNTASAN MINIMAL ( KKM )

KRITERIA KETUNTASAN MINIMAL ( KKM ) KRITERIA KETUNTASAN MINIMAL ( KKM ) MATA PELAJARAN : PENDIDIKAN KEWARGANEGARAAN KELAS 2 SEMESTER I 17 PERHITUNGAN KRITERIA KETUNTASAN MINIMUM Nama Sekolah : SD/MI... Kelas/semester : II (Dua)/ 1 (satu)

Lebih terperinci

32. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas (SMA)/ Madrasah Aliyah (MA)

32. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas (SMA)/ Madrasah Aliyah (MA) 32. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas (SMA)/ Madrasah Aliyah (MA) A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta

Lebih terperinci

STANDAR KOMPETENSI DAN KOMPETENSI DASAR TEMATIK KELAS I (1) Mengenal bagian-bagian anggota tubuh dan kegunaannya serta cara perawatannya.

STANDAR KOMPETENSI DAN KOMPETENSI DASAR TEMATIK KELAS I (1) Mengenal bagian-bagian anggota tubuh dan kegunaannya serta cara perawatannya. STANDAR KOMPETENSI DAN TEMATIK KELAS I (1) TEMA: Diri Sendiri KELAS 1 SEMESTER 1 Stándar Kompetensi 1. IPS : Memahami identitas diri dan keluarga serta sikap saling menghormati dalam kemajemukan keluarga.

Lebih terperinci

Pengkajian Standar Isi dan Standar Kompetensi (KTSP)

Pengkajian Standar Isi dan Standar Kompetensi (KTSP) Pengkajian Standar Isi dan Standar Kompetensi (KTSP) Bagaimana menyikapi informasi? Menerima informasi Menyaring informasi Mengolah informasi Menghasilkan informasi Badai Informasi B B M K D B M T M S

Lebih terperinci

SILABUS BAHASA JAWA KURIKULUM TINGKAT SATUAN PENDIDIKAN SEKOLAH DASAR JAWA TENGAH

SILABUS BAHASA JAWA KURIKULUM TINGKAT SATUAN PENDIDIKAN SEKOLAH DASAR JAWA TENGAH SILABUS BAHASA JAWA KURIKULUM TINGKAT SATUAN PENDIDIKAN SEKOLAH DASAR JAWA TENGAH Standar Kompetensi Kompetensi Dasar Indikator Materi Pokok Keterangan Kelas 1 1. Mendengarkan Mampu mendengarkan dan memahami

Lebih terperinci

KRITERIA KETUNTASAN MINIMAL

KRITERIA KETUNTASAN MINIMAL Mata Pelajaran Kelas/Semester : BAHASA INDONESIA : IV (C dan D) / Ganjil STANDAR KOMPETENSI KOMPETENSI DASAR INDIKATOR MENDENGARKAN 1. Mendengarkan tentang petunjuk denah dan symbol/lambing Korps 1.1 Menjelaskan

Lebih terperinci

BAB II KAJIAN PUSTAKA

BAB II KAJIAN PUSTAKA BAB II KAJIAN PUSTAKA 2.1. Kajian Teori 2.1.1 Hasil Belajar Menurut Sudjana (2011: 22), hasil belajar adalah kemampuan-kemampuan yang dimiliki siswa setelah menerima pengalaman belajarnya. Pengalaman belajar

Lebih terperinci

TEMATIK KELAS II SEMESTER 1

TEMATIK KELAS II SEMESTER 1 TEMATIK KELAS II SEMESTER 1 560 Prrotah Tematik PROGRAM TAHUNAN Satuan Pendidikan :. Kelas : II Semester : I Tahun : 20 /20 Smtr Tema Stándar Kompetensi 1 Diri Sendiri 1. PKn Membiasakan hidup bergotong

Lebih terperinci

BAB I PENDAHULUAN. Pembelajaran bahasa Indonesia sangat diperlukan bagi perkembangan

BAB I PENDAHULUAN. Pembelajaran bahasa Indonesia sangat diperlukan bagi perkembangan 1 BAB I PENDAHULUAN 1.1 Latar Belakang Masalah Pembelajaran bahasa Indonesia sangat diperlukan bagi perkembangan pendidikan. Mempelajari bahasa Indonesia, berarti ikut serta menjaga dan melestarikan bahasa

Lebih terperinci

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS I SEMESTER 2 TEMA: PERMAINAN

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS I SEMESTER 2 TEMA: PERMAINAN STANDAR KOMPETENSI IPS : Mendeskripsikan lingkungan rumah SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS I SEMESTER 2 TEMA: PERMAINAN KOMPETENSI DASAR INDIKATOR PENCAPAIAN KOMPETENSI LANGKAH PEMBELAJARAN

Lebih terperinci

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS VI SEMESTER 1

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS VI SEMESTER 1 PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS VI SEMESTER 1 1 MATA PELAJARAN : Bahasa Indonesia KELAS / SEMESTER : VI (enam) / 1 (satu) Standar Kompetensi : 1. Memahami teks dan cerita anak

Lebih terperinci

PROGRAM TAHUNAN PEMBELAJARAN TEMATIK KELAS I SEMESTER 2 SEKOLAH DASAR (SD)/MADRASAH IBTIDAIYAH (MI)

PROGRAM TAHUNAN PEMBELAJARAN TEMATIK KELAS I SEMESTER 2 SEKOLAH DASAR (SD)/MADRASAH IBTIDAIYAH (MI) PROGRAM TAHUNAN PEMBELAJARAN TEMATIK KELAS I SEMESTER 2 SEKOLAH DASAR (SD)/MADRASAH IBTIDAIYAH (MI) 1 PROGRAM TAHUNAN Satuan Pendidikan :... Kelas : I Semester : 2 Tahun : No Smtr Tema Stándar Kompetensi

Lebih terperinci

Kompetensi Dasar : 1. IPS : Menunjukkan sikap hidup rukun dalam kemajemukan keluarga.

Kompetensi Dasar : 1. IPS : Menunjukkan sikap hidup rukun dalam kemajemukan keluarga. RENCANAN PELAKSANAAN PEMBELAJARAN (RPP) TEMATIK 4 Nama Sekolah : SDN Sekarsari Tema : Kegemaran Kelas/Semester : I / 1 Alokasi Waktu : 3 minggu Standar Kompetensi : 1. IPS : Memahami identitas diri dan

Lebih terperinci

SILABUS BAHASA INDONESIA KELAS VI SEMESTER 2 TAHUN PELAJARAN

SILABUS BAHASA INDONESIA KELAS VI SEMESTER 2 TAHUN PELAJARAN SILABUS BAHASA INDONESIA KELAS VI SEMESTER 2 TAHUN PELAJARAN 2009-2010 Kompetensi Dasar MENDENGARKAN 1.1 Menyimpulkan isi berita yang didengar dari televisi atau radio. Indikator Pencapaian (peserta didik

Lebih terperinci

RENCANA PELAKSANAAN PEMBELAJARAN

RENCANA PELAKSANAAN PEMBELAJARAN Nama Sekolah Kelas / Jurusan Semester : BHUDI DARMA : IV (Empat) : I (satu) : ( 8 Jam Pelajaran ) 3 x Pertemuan A. Standar Kompetensi : 2. Mendeskripsikan secara lisan tempat sesuai denah dan petunjuk

Lebih terperinci

Nama Sekolah : Kelas / Semester : 2 / 2 : Lingkungan Waktu : 4 minggu

Nama Sekolah : Kelas / Semester : 2 / 2 : Lingkungan Waktu : 4 minggu Nama Sekolah : Kelas / Semester : 2 / 2 Tema : Lingkungan Waktu : 4 minggu Standar Kompetensi B. Indonesia Berbicara RENCANAN PELAKSANAAN PEMBELAJARAN (RPP) TEMATIK Mengungkapkan secara lisan beberapa

Lebih terperinci

PROGRAM TAHUNAN Mata Pelajaran PKn Kelas 2

PROGRAM TAHUNAN Mata Pelajaran PKn Kelas 2 Mata Pelajaran PKn 1 1. Membiasakan hidup gotong royong 1.1 mengenal pentingnya hidup rukun, saling berbagi dan tolong menolong. 2. Menampilkan sikap cinta 1.2 Melaksanakan hidup rukun, lingkungan saling

Lebih terperinci

SD/MI/SDLB Standar Isi

SD/MI/SDLB Standar Isi KISI-KISI UJIAN NASIONAL TAHUN PELAJARAN 2012/2013 A. KISI-KISI UJIAN NASIONAL SD/MI 1. BAHASA INDONESIA SD/MI NO. KOMPETENSI INDIKATOR 1. Membaca Disajikan teks bacaan 3 4 paragraf, siswa dapat: Membaca

Lebih terperinci

KISI PLPG 2013 MATA PELAJARAN GURU KELAS SD

KISI PLPG 2013 MATA PELAJARAN GURU KELAS SD KISI PLPG 2013 MATA PELAJARAN GURU KELAS SD Kompetensi Utama Standar Kompetensi Guru Sekolah Dasar Kompetensi Inti Guru (Standar Kompetensi) Kompetensi Guru SD (Kompetensi Dasar) Standar Kompetensi Standar

Lebih terperinci

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS III SEMESTER 2

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS III SEMESTER 2 PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS III SEMESTER 2 1 PROGRAM SEMESTER TAHUN PELAJARAN 20 / 20 MATA PELAJARAN : Bahasa Indonesia KELAS / SEMESTER : III (Tiga) / 2 (dua) Standar Kompetensi

Lebih terperinci

TEMATIK KELAS III SEMESTER 1

TEMATIK KELAS III SEMESTER 1 TEMATIK KELAS III SEMESTER 1 560 Prrotah Tematik PROGRAM TAHUNAN Satuan Pendidikan :. Kelas : III Semester : I Tahun : 20 /20 Smtr Tema Stándar Kompetensi 1 LINGKUNGAN 1. PKN : Mengamalkan makna Sumpah

Lebih terperinci

Berbahasa dan Bersastr

Berbahasa dan Bersastr Hak Cipta pada Departemen Pendidikan Nasional Dilindungi Undang-undang Hak Cipta Buku ini dibeli Oleh Departemen Pendidikan Nasional dari Penerbit Usaha Makmur, CV Berbahasa dan Bersastr sastra a Indonesia

Lebih terperinci

Soal Uji Kompetensi Pascasertifikasi Sekolah Dasar. Standar Kompetensi Guru Sekolah Dasar

Soal Uji Kompetensi Pascasertifikasi Sekolah Dasar. Standar Kompetensi Guru Sekolah Dasar Soal Uji Kompetensi Pascasertifikasi Sekolah Dasar Kompetensi Utama secara luas dan Standar Kompetensi Guru Sekolah Dasar Kompetensi Inti Guru Kompetensi Guru SD (Standar Kompetensi) (Kompetensi Dasar)

Lebih terperinci

RENCANA PEMBELAJARAN TEMATIK

RENCANA PEMBELAJARAN TEMATIK RENCANA PEMBELAJARAN TEMATIK NAMA SEKOLAH :... TEMA : KEGEMARAN KELAS /SEMESTER : 3 (Tiga)/2 (Dua) ALOKASI WAKTU : 3 MINGGU A. STANDAR KOMPETENSI I. PKN Memiliki harga diri sebagai individu Memiliki kebanggaan

Lebih terperinci

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS VI SEMESTER 2

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS VI SEMESTER 2 PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS VI SEMESTER 2 1 PROGRAM SEMESTER TAHUN PELAJARAN 20 / 20 MATA PELAJARAN : Bahasa Indonesia KELAS / SEMESTER : VI (Enam) / 2 (dua) Standar Kompetensi

Lebih terperinci

- Penerapan konsep energi gerak

- Penerapan konsep energi gerak IPA NO KOMPETENSI DASAR MATERI INDIKATOR 1 Menyimpulkan hasil pengamatan bahwa gerak benda di pengaruhi oleh bentuk dan ukuran - Gerak benda - Siswa dapat menjelaskan gerak benda yang berbentuk bulat -

Lebih terperinci

4. BAHASA INDONESIA SDLB A, D, DAN E (TUNANETRA, TUNA DAKSA RINGAN, DAN TUNA LARAS)

4. BAHASA INDONESIA SDLB A, D, DAN E (TUNANETRA, TUNA DAKSA RINGAN, DAN TUNA LARAS) B. KISI-KISI UJIAN NASIONAL SDLB 4. BAHASA INDONESIA SDLB A, D, DAN E (TUNANETRA, TUNA DAKSA RINGAN, DAN TUNA LARAS) NO. KOMPETENSI INDIKATOR 1. Membaca dan memahami berbagai bentuk teks bacaan nonsastra

Lebih terperinci

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS V SEMESTER

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS V SEMESTER PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS V SEMESTER 1 1 PROGRAM SEMESTER TAHUN PELAJARAN 20 / 20 MATA PELAJARAN : Bahasa Indonesia KELAS / SEMESTER : V (Lima) / 1 (satu) Standar Kompetensi

Lebih terperinci

KISI-KISI UJIAN SEKOLAH DASAR/MADRASAH IBTIDAIYAH UJIAN PRAKTIK

KISI-KISI UJIAN SEKOLAH DASAR/MADRASAH IBTIDAIYAH UJIAN PRAKTIK KISI-KISI UJIAN SEKOLAH DASAR/MADRASAH IBTIDAIYAH UJIAN PRAKTIK Mata Pelajaran Jumlah Soal : Bahasa Indonesia : 10 Soal No. Urut Standar Kompetensi Kompetensi Dasar Kelas Indikator No soal 1. 1. Memahami

Lebih terperinci

Kompetensi Dasar : 1. IPS : Menunjukkan sikap hidup rukun dalam kemajemukan keluarga. 2. IPA : Membedakan lingkungan sehat dan tidak sehat.

Kompetensi Dasar : 1. IPS : Menunjukkan sikap hidup rukun dalam kemajemukan keluarga. 2. IPA : Membedakan lingkungan sehat dan tidak sehat. RENCANAN PELAKSANAAN PEMBELAJARAN (RPP) TEMATIK Nama Sekolah :... Tema : Budi Pekerti Kelas/Semester : I / 1 Alokasi Waktu : 2 minggu Standar Kompetensi : 1. IPS : Memahami identitas diri dan keluarga

Lebih terperinci

Kisi-Kisi Uji Kompetensi Guru Tahun 2012

Kisi-Kisi Uji Kompetensi Guru Tahun 2012 Mata Pelajaran : Bahasa Indonesia Jenjang : SMP/SMA Kisi-Kisi Uji Kompetensi Guru Tahun 2012 1. Mengungkapkan secara lisan wacana nonsastra 1.1 Menggunakan wacana lisan untuk wawancara 1.1.1 Disajikan

Lebih terperinci

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS IV SEMESTER 2

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS IV SEMESTER 2 PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS IV SEMESTER 2 1 MATA PELAJARAN : BAHASA INDONESIA Standar Kompetensi : 5. Mendengarkan pengumuman dan pembacaan pantun MENDENGARKAN 5.1.Menyampaikan

Lebih terperinci

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS I SEMESTER 2

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS I SEMESTER 2 PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS I SEMESTER 2 1 PROGRAM SEMESTER Standar Kompetensi : 5. Memahami wacana lisan tentang deskripsi bendabenda di sekitar dan dongeng MENDENGARKAN

Lebih terperinci

Kisi-Kisi Uji Kompetensi Awal Sertifikasi Guru Tahun 2012

Kisi-Kisi Uji Kompetensi Awal Sertifikasi Guru Tahun 2012 Mata Pelajaran : Bahasa Indonesia Jenjang : SMP/SMA Kisi-Kisi Uji Kompetensi Awal Sertifikasi Guru Tahun 2012 1. Mengungkapkan secara lisan wacana nonsastra 2. Mengungkapkan wacana tulis nonsastra 1.1

Lebih terperinci

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS I SEMESTER 2 TEMA: PERISTIWA

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS I SEMESTER 2 TEMA: PERISTIWA STANDAR IPS : Mendeskripsikan lingkungan rumah SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS I SEMESTER 2 TEMA: PERISTIWA DASAR INDIKATOR PENCAPAIAN LANGKAH PEMBELAJARAN ALKS. WAKTU SARANA DAN SUMBER

Lebih terperinci

qwertyuiopasdfghjklzxcvbnmqw ertyuiopasdfghjklzxcvbnmqwert yuiopasdfghjklzxcvbnmqwertyui opasdfghjklzxcvbnmqwertyuiop asdfghjklzxcvbnmqwertyuiopas

qwertyuiopasdfghjklzxcvbnmqw ertyuiopasdfghjklzxcvbnmqwert yuiopasdfghjklzxcvbnmqwertyui opasdfghjklzxcvbnmqwertyuiop asdfghjklzxcvbnmqwertyuiopas qwertyuiopasdfghjklzxcvbnmqw ertyuiopasdfghjklzxcvbnmqwert yuiopasdfghjklzxcvbnmqwertyui PROGRAM TAHUNAN GURU opasdfghjklzxcvbnmqwertyuiop KELAS : IV ( empat ) asdfghjklzxcvbnmqwertyuiopas - 2014 dfghjklzxcvbnmqwertyuiopasdf

Lebih terperinci

SALINAN LAMPIRAN PERATURAN MENTERI PENDIDIKAN NASIONAL NOMOR 39 TAHUN 2007 TANGGAL 16 NOVEMBER 2007

SALINAN LAMPIRAN PERATURAN MENTERI PENDIDIKAN NASIONAL NOMOR 39 TAHUN 2007 TANGGAL 16 NOVEMBER 2007 SALINAN LAMPIRAN PERATURAN MENTERI PENDIDIKAN NASIONAL NOMOR 39 TAHUN 2007 TANGGAL 16 NOVEMBER 2007 UJIAN AKHIR SEKOLAH BERSTANDAR NASIONAL 2008 (SKL UASBN 2008) 1. BAHASA INDONESIA SD/MI 1. Membaca Memahami

Lebih terperinci

SD/MI/SDLB Standar Isi

SD/MI/SDLB Standar Isi KISI-KISI UJIAN NASIONAL TAHUN PELAJARAN 2012/2013 A. KISI-KISI UJIAN NASIONAL SD/MI 1. BAHASA INDONESIA SD/MI NO. KOMPETENSI INDIKATOR 1. Membaca Disajikan teks bacaan 3 4 paragraf, siswa dapat: Membaca

Lebih terperinci

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS 1 SEMESTER 2 TEMA: LINGKUNGAN

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS 1 SEMESTER 2 TEMA: LINGKUNGAN SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS 1 SEMESTER 2 TEMA: LINGKUNGAN Standar Dasar IPS : Mendeskripsikan lingkungan rumah IPA/ Sains : Mengenal berbagai bentuk energi, manfaatnya dalam kehidupan

Lebih terperinci

PROGRAM TAHUNAN (PROTA)

PROGRAM TAHUNAN (PROTA) Mata Pelajaran : P Kn Kelas : IV (Empat) 1. 3. 4. 18 x1 jam 18 x1 jam 14 x1 jam 18 x1 jam SISTEM PEMERINTAHAN DESA DAN KECAMATAN A. Pemerintahan Desa B. Pemerintahan Kelurahan C. Pemerintahan Kecamatan

Lebih terperinci

KISI-KISI UJIAN NASIONAL TAHUN PELAJARAN 2012/2013

KISI-KISI UJIAN NASIONAL TAHUN PELAJARAN 2012/2013 KISI-KISI UJIAN NASIONAL TAHUN PELAJARAN 2012/2013 A. KISI-KISI UJIAN NASIONAL SD/MI 1. BAHASA INDONESIA SD/MI NO. KOMPETENSI INDIKATOR 1. Membaca Disajikan teks bacaan 3 4 paragraf, siswa dapat: Membaca

Lebih terperinci

KISI-KISI UJIAN NASIONAL TAHUN PELAJARAN 2011/2012. NO. KOMPETENSI INDIKATOR 1. Membaca

KISI-KISI UJIAN NASIONAL TAHUN PELAJARAN 2011/2012. NO. KOMPETENSI INDIKATOR 1. Membaca KISI-KISI UJIAN NASIONAL TAHUN PELAJARAN 2011/2012 A. KISI-KISI UJIAN NASIONAL SD/MI 1. BAHASA INDONESIA SD/MI NO. KOMPETENSI INDIKATOR 1. Membaca Disajikan teks bacaan 3 4 paragraf, siswa dapat: Membaca

Lebih terperinci

90. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas (SMA)/ Madrasah Aliyah (MA) Program Bahasa

90. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas (SMA)/ Madrasah Aliyah (MA) Program Bahasa 90. Mata Pelajaran Bahasa Indonesia untuk Sekolah Menengah Atas (SMA)/ Madrasah Aliyah (MA) Program Bahasa A. Latar Belakang Mata pelajaran Bahasa Indonesia untuk Program Bahasa ini berorientasi pada hakikat

Lebih terperinci

SILABUS PEMBELAJARAN

SILABUS PEMBELAJARAN Nama Sekolah :... : Kelas / Semester : V / 2 SILABUS PEMBELAJARAN Dasar Alokasi Waktu 5. Mendengarkan Memehami tentang suatu peristiwa dan pendek anak yang disampaikan secara lisan 5.1 Menang-gapi tentang

Lebih terperinci

Rencana Pelaksanaan Pembelajaran (RPP)

Rencana Pelaksanaan Pembelajaran (RPP) Pertemuan Ke- : 1, 2, 3, 4 Alokasi Waktu : 4 40 menit Standar Kompetensi : Memahami pembacaan puisi Kompetensi Dasar : Menanggapi cara pembacaan puisi 1. mengungkapkan isi puisi 2. menangkap isi puisi

Lebih terperinci

Silabus dan Rencana Pelaksanaan Pembelajaran (RPP) Pelajaran Bahasa dan Sastra Indonesia

Silabus dan Rencana Pelaksanaan Pembelajaran (RPP) Pelajaran Bahasa dan Sastra Indonesia Surana MODEL Silabus dan Rencana Pelaksanaan Pembelajaran (RPP) Aku Cinta Bahasa Indonesia Pelajaran Bahasa dan Sastra Indonesia 3A untuk Kelas III SD dan MI Semester 1 Berdasarkan Permendiknas Nomor 22

Lebih terperinci

BAB II KAJIAN PUSTAKA

BAB II KAJIAN PUSTAKA 7 BAB II KAJIAN PUSTAKA A. Keterampilan Menulis Pantun 1. Keterampilan tugas tertentu. 2. Hakikat Menulis Keterampilan merupakan suatu kecakapan untuk menyelesaikan Menulis merupakan salah satu kegiatan

Lebih terperinci

Nama Sekolah :... : Budi Pekerti Kelas/Semester : I / 2 Alokasi Waktu : 3 minggu

Nama Sekolah :... : Budi Pekerti Kelas/Semester : I / 2 Alokasi Waktu : 3 minggu RENCANAN PELAKSANAAN PEMBELAJARAN (RPP) TEMATIK Nama Sekolah :... Tema : Budi Pekerti Kelas/Semester : I / 2 Alokasi Waktu : 3 minggu Standar Kompetensi : 1. PKn : Menerapkan kewajiban anak di rumah dan

Lebih terperinci

Rencana Pelaksanaan Pembelajaran Tematik

Rencana Pelaksanaan Pembelajaran Tematik Nama Sekolah : SD Negeri 1 Pagerpelah Kelas/Semester : 2 / 1 Tema : Kasih Sayang Alokasi Waktu : 2 Minggu Pelaksanaan : Minggu ke-1 s.d. 2 Rencana Pelaksanaan Pembelajaran Tematik A. Kompetensi Dasar Mengenal

Lebih terperinci

PROGRAM EVALUASI. Mata Pelajaran : Pendidikan Kewarganegaraan Semester : Ganjil Kelas : I (Satu) Tahun Pelajaran : 2011/2012

PROGRAM EVALUASI. Mata Pelajaran : Pendidikan Kewarganegaraan Semester : Ganjil Kelas : I (Satu) Tahun Pelajaran : 2011/2012 PROGRAM EVALUASI Mata Pelajaran : Pendidikan Kewarganegaraan Semester : Ganjil Kelas : I (Satu) Tahun Pelajaran : 2011/2012 No. Juli Agustus September Oktober Nopember Desember Hidup rukun 1. a. Perbedaan

Lebih terperinci

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS 1 SEMESTER 1 TEMA: Budi Pekerti

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS 1 SEMESTER 1 TEMA: Budi Pekerti SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS 1 SEMESTER 1 TEMA: Budi Pekerti Standar 1. IPS : Memahami identitas diri dan keluarga serta sikap saling menghormati dalam keluarga. Dasar Menunjukkan sikap

Lebih terperinci

Matematika 1. Melakukan operasi hitung bilangan sampai tiga angka 2. Menggunakan pengukuran waktu, panjang dan berat dalam memecahkan masalah

Matematika 1. Melakukan operasi hitung bilangan sampai tiga angka 2. Menggunakan pengukuran waktu, panjang dan berat dalam memecahkan masalah RENCANAN PELAKSANAAN PEMBELAJARAN (RPP) TEMATIK Nama Sekolah :... Tema : Kegiatan Kelas/Semester : III / 1 Alokasi Waktu : 2 minggu I. STANDAR KOMPETENSI I. PKn 1. Mengamalkan makna Sumpah Pemuda II. III.

Lebih terperinci

KRITERIA KETUNTASAN MINIMAL (KKM) KELAS I (SATU) TAHUN PELAJARAN 2010/2011

KRITERIA KETUNTASAN MINIMAL (KKM) KELAS I (SATU) TAHUN PELAJARAN 2010/2011 KELAS I (SATU) TAHUN PELAJARAN 2010/2011 No. Mata Pelajaran KKM Semester 1 Semester 2 Keterangan 1. an Agama 2. an Kewarganegaraan 3. Bahasa Indonesia 4. Matematika 5. Ilmu Pengetahuan Alam 6. Ilmu Pengetahuan

Lebih terperinci

Memahami wacana lisan tentang benda-benda di sekitar dan dongeng.

Memahami wacana lisan tentang benda-benda di sekitar dan dongeng. RENCANAN PELAKSANAAN PEMBELAJARAN (RPP) TEMATIK Nama Sekolah :... Tema : Permainan Kelas/Semester : I / 2 Alokasi Waktu : 3 minggu Standar Kompetensi : 1. PKn : Menerapkan kewajiban anak di rumah dan di

Lebih terperinci

SEKOLAH DASAR (SD) / MADRASAH IBTIDAIYAH (MI)

SEKOLAH DASAR (SD) / MADRASAH IBTIDAIYAH (MI) MATA PELAJARAN : BAHASA INDONESIA KELAS V SEMESTER 2 SEKOLAH DASAR (SD) / MADRASAH IBTIDAIYAH (MI) PROGRAM TAHUNAN Mata Pelajaran : Bahasa Indonesia. Satuan Pendidikan : SD No. 44/VII Sukasari I Kelas

Lebih terperinci

KURIKULUM 2004 STANDAR KOMPETENSI. Mata Pelajaran

KURIKULUM 2004 STANDAR KOMPETENSI. Mata Pelajaran KURIKULUM 2004 STANDAR KOMPETENSI Mata Pelajaran BAHASA INDONESIA SEKOLAH DASAR dan MADRASAH IBTIDAIYAH DEPARTEMEN PENDIDIKAN NASIONAL Jakarta, Tahun 2003 Katalog dalam Terbitan Indonesia. Pusat Kurikulum,

Lebih terperinci

Nama Sekolah : Kelas / Semester : 2 (Dua/ 2 (dua) : Kegiatan Sehari-hari

Nama Sekolah : Kelas / Semester : 2 (Dua/ 2 (dua) : Kegiatan Sehari-hari RENCANAN PELAKSANAAN PEMBELAJARAN (RPP) TEMATIK Nama Sekolah : Kelas / Semester : 2 (Dua/ 2 (dua) Tema : Kegiatan Sehari-hari Waktu : 3 Minggu Standar Kompetensi PKn Membiasakan hidup bergotong royong

Lebih terperinci

KISI UJI KOMPETENSI 2014 MATA PELAJARAN BAHASA INDONESIA

KISI UJI KOMPETENSI 2014 MATA PELAJARAN BAHASA INDONESIA KISI UJI KOMPETENSI 2014 MATA PELAJARAN BAHASA INDONESIA Standar Guru C C2 C3 C4 C5 C6 Menggunakan secara lisan wacana wacana lisan untuk wawancara Menggunakan wacana lisan untuk wawancara Disajikan penggalan

Lebih terperinci

IPS 1. Memahami lingkungan dan melaksanakan kerjasama di sekitar rumah dan sekolah

IPS 1. Memahami lingkungan dan melaksanakan kerjasama di sekitar rumah dan sekolah RENCANAN PELAKSANAAN PEMBELAJARAN (RPP) TEMATIK Nama Sekolah :... Tema : Pengalaman Kelas/Semester : III / 1 Alokasi Waktu : 3 minggu I. STANDAR KOMPETENSI PKn 1. Mengamalkan makna Sumpah Pemuda IPS 1.

Lebih terperinci

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS I - SEMESTER 1

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS I - SEMESTER 1 PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS I - SEMESTER 1 1 PROGRAM SEMESTER TAHUN PELAJARAN 20 / 20 MATA PELAJARAN : Bahasa Indonesia KELAS / SEMESTER : I (Satu) / 1 (satu) Standar Kompetensi

Lebih terperinci

SILABUS. Kegiatan Pembelajaran

SILABUS. Kegiatan Pembelajaran KELAS XII SEMESTER 1 SILABUS Semester : 1 Standar : Mendengarkan 1. Memahami informasi dari berbagai laporan 1.1 Membedakan antara fakta dan opini dari berbagai laporan lisan Laporan laporan kegiatan OSIS

Lebih terperinci

Nama Sekolah :... Kelas/Semester : I / 2 Alokasi Waktu : 2 minggu

Nama Sekolah :... Kelas/Semester : I / 2 Alokasi Waktu : 2 minggu RENCANAN PELAKSANAAN PEMBELAJARAN (RPP) TEMATIK Nama Sekolah :... Tema : Keluarga Kelas/Semester : I / 2 Alokasi Waktu : 2 minggu Standar Kompetensi : 1. PKn : Menerapkan kewajiban anak di rumah dan di

Lebih terperinci

Nama Sekolah : SDN Sekarsari. Kelas/Semester : I / 1 Alokasi Waktu : 3 minggu

Nama Sekolah : SDN Sekarsari. Kelas/Semester : I / 1 Alokasi Waktu : 3 minggu RENCANAN PELAKSANAAN PEMBELAJARAN (RPP) TEMATIK 3 Nama Sekolah : SDN Sekarsari Tema : Keluarga Kelas/Semester : I / 1 Alokasi Waktu : 3 minggu Standar Kompetensi : 1. IPS : Memahami identitas diri dan

Lebih terperinci

PROGRAM EVALUASI. Mata Pelajaran : Pendidikan Kewarganegaraan Semester : Ganjil. Kelas : IV Tahun Pelajaran : 2011/2012. Kudus, 11 Juli 2011 Guru PKn,

PROGRAM EVALUASI. Mata Pelajaran : Pendidikan Kewarganegaraan Semester : Ganjil. Kelas : IV Tahun Pelajaran : 2011/2012. Kudus, 11 Juli 2011 Guru PKn, PROGRAM EVALUASI Mata Pelajaran : Pendidikan Kewarganegaraan Semester : Ganjil Kelas : IV Tahun Pelajaran : 2011/2012 No. Juli Agustus September Oktober Nopember Desember 1. SISTEM PEMERINTAHAN DESA DAN

Lebih terperinci

STANDAR KOMPETENSI DAN KOMPETENSI DASAR TINGKAT SD, MI, DAN SDLB. 1.1 Melafalkan QS Al-Fatihah dengan lancar 1.2 Menghafal QS Al-Fatihah dengan lancar

STANDAR KOMPETENSI DAN KOMPETENSI DASAR TINGKAT SD, MI, DAN SDLB. 1.1 Melafalkan QS Al-Fatihah dengan lancar 1.2 Menghafal QS Al-Fatihah dengan lancar STANDAR KOMPETENSI DAN KOMPETENSI DASAR TINGKAT SD, MI, DAN SDLB MATA PELAJARAN PENDIDIKAN AGAMA ISLAM Kelas I, Semester 1 Al Qur an 1. Menghafal Al Qur an surat pendek pilihan 1.1 Melafalkan QS Al-Fatihah

Lebih terperinci

BAB I PENDAHULUAN. dan emosional peserta didik serta merupakan penunjang keberhasilan dalam

BAB I PENDAHULUAN. dan emosional peserta didik serta merupakan penunjang keberhasilan dalam 1 BAB I PENDAHULUAN A. Latar Belakang Bahasa memiliki peran sentral dalam perkembangan intelektual, sosial, dan emosional peserta didik serta merupakan penunjang keberhasilan dalam mempelajari semua bidang

Lebih terperinci

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS II SEMESTER 2 TEMA: KEGIATAN SEHARI-HARI

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS II SEMESTER 2 TEMA: KEGIATAN SEHARI-HARI SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS II SEMESTER 2 TEMA: KEGIATAN SEHARI-HARI Standar Dasar PKn Membiasakan hidup bergotong royong pentingnya hidup rukun, saling berbagi dan tolong menolong

Lebih terperinci

Nama Sekolah : Kelas / Semester : 2 (Dua) / 2 (Dua) : Kesehatan Waktu : 2 Minggu

Nama Sekolah : Kelas / Semester : 2 (Dua) / 2 (Dua) : Kesehatan Waktu : 2 Minggu RENCANAN PELAKSANAAN PEMBELAJARAN (RPP) TEMATIK Nama Sekolah : Kelas / Semester : (Dua) / (Dua) Tema : Kesehatan Waktu : Minggu STANDAR KOMPETENSI Mendengarkan Memahami pesan pendek dan dongeng yang dilisankan

Lebih terperinci

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS II SEMESTER 1 TEMA: PERISTIWA

SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS II SEMESTER 1 TEMA: PERISTIWA SILABUS PEMBELAJARAN TEMATIK SEKOLAH DASAR KELAS II SEMESTER 1 TEMA: PERISTIWA Standar Dasar 1. PKn Membiasakan hidup bergotong royong 2. IPS Memahami peristiwa penting dalam keluarga secara kronologis

Lebih terperinci

BAB I PENDAHULUAN. A. Latar Belakang Penelitian Bahasa memiliki peranan yang penting dalam perkembangan

BAB I PENDAHULUAN. A. Latar Belakang Penelitian Bahasa memiliki peranan yang penting dalam perkembangan 1 BAB I PENDAHULUAN A. Latar Belakang Penelitian Bahasa memiliki peranan yang penting dalam perkembangan intelektual, sosial, dan emosional siswa serta menunjang keberhasilan mempelajari semua bidang studi.

Lebih terperinci

RENCANA PEMBELAJARAN TEMATIK

RENCANA PEMBELAJARAN TEMATIK RENCANA PEMBELAJARAN TEMATIK NAMA SEKOLAH :... TEMA : KEPERLUAN SEHARI HARI KELAS /SEMESTER : 3 (Tiga)/2 (Dua) ALOKASI WAKTU : 4 MINGGU A. STANDAR KOMPETENSI I. PKN 3. Memiliki harga diri sebagai individu

Lebih terperinci

Mata Pelajaran : Tematik Satuan Pendidikan : SD/MI Kelas/Semester : II / 1. Nama Guru :... NIP/NIK :... Sekolah :...

Mata Pelajaran : Tematik Satuan Pendidikan : SD/MI Kelas/Semester : II / 1. Nama Guru :... NIP/NIK :... Sekolah :... PERANGKAT PEMBELAJARAN SPIDER WEB JARINGAN INDIKATOR PENCAPAIAN KOMPETENSI Mata Pelajaran : tik Satuan Pendidikan : SD/MI Kelas/Semester : II / 1 Nama Guru :... NIP/NIK :... Sekolah :... KURIKULUM TINGKAT

Lebih terperinci

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS IV SEMESTER 1

PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS IV SEMESTER 1 PROGRAM PEMBELAJARAN BAHASA INDONESIA SEKOLAH DASAR KELAS IV SEMESTER 1 1 PROGRAM SEMESTER TAHUN PELAJARAN 20 / 20 MATA PELAJARAN : Bahasa Indonesia KELAS / SEMESTER : IV (Empat) / 1 (satu) Standar Kompetensi

Lebih terperinci

KISI-KISI UJIAN NASIONAL SEKOLAH MENENGAH PERTAMA LUAR BIASA KETUNAAN NETRA, KETUNAAN DAKSA, DAN KETUNAAN RUNGU TAHUN PELAJARAN 2018/2019

KISI-KISI UJIAN NASIONAL SEKOLAH MENENGAH PERTAMA LUAR BIASA KETUNAAN NETRA, KETUNAAN DAKSA, DAN KETUNAAN RUNGU TAHUN PELAJARAN 2018/2019 KISI-KISI UJIAN NASIONAL SEKOLAH MENENGAH PERTAMA LUAR BIASA KETUNAAN NETRA, KETUNAAN DAKSA, DAN KETUNAAN RUNGU TAHUN PELAJARAN 2018/2019 A. KETUNAAN NETRA 1. Bahasa Indonesia Pemahaman Menentukan Memaknai

Lebih terperinci